Solution structure human HCN2 CNBD in the cAMP-unbound state
GPSSPMELNG PLREEIVNFN CRKLVASMPL FANADPNFVT AMLTKLKFEV FQPGDYIIRE GTIGKKMYFI QHGVVSVLTK GNKEMKLSDG SYFGEICLLT RGRRTASVRA DTYCRLYSLS VDNFNEVLEE YPMMRRAFET VAIDRLDRIG KKNSILLH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.3 % (1697 of 1880) | 94.1 % (924 of 982) | 84.8 % (624 of 736) | 92.0 % (149 of 162) |
Backbone | 92.9 % (868 of 934) | 93.8 % (300 of 320) | 92.4 % (428 of 463) | 92.7 % (140 of 151) |
Sidechain | 88.9 % (972 of 1093) | 94.3 % (624 of 662) | 80.7 % (339 of 420) | 81.8 % (9 of 11) |
Aromatic | 47.3 % (69 of 146) | 93.2 % (68 of 73) | 1.4 % (1 of 73) | |
Methyl | 99.4 % (175 of 176) | 100.0 % (88 of 88) | 98.9 % (87 of 88) |
1. entity
GPSSPMELNG PLREEIVNFN CRKLVASMPL FANADPNFVT AMLTKLKFEV FQPGDYIIRE GTIGKKMYFI QHGVVSVLTK GNKEMKLSDG SYFGEICLLT RGRRTASVRA DTYCRLYSLS VDNFNEVLEE YPMMRRAFET VAIDRLDRIG KKNSILLHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | potassium chloride | natural abundance | 150 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity | natural abundance | 1 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | potassium chloride | natural abundance | 150 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | dioxane | methylene carbons | 69.4 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | dioxane | methylene carbons | 69.4 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | dioxane | methylene carbons | 69.4 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | dioxane | methylene carbons | 69.4 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz equipped with a TCI-cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM |
Bruker Avance - 800 MHz equipped with a QXI-HCN gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | potassium chloride | natural abundance | 150 mM |
Bruker Avance - 800 MHz equipped with a QXI-HCN gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | potassium chloride | natural abundance | 150 mM |
Bruker Avance - 800 MHz equipped with a QXI-HCN gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | potassium chloride | natural abundance | 150 mM |
Bruker Avance - 800 MHz equipped with a QXI-HCN gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | potassium chloride | natural abundance | 150 mM |
Bruker Avance - 800 MHz equipped with a QXI-HCN gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-15N] | 1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 150 mM |
Bruker Avance - 800 MHz equipped with a QXI-HCN gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | potassium chloride | natural abundance | 150 mM |
Bruker Avance - 600 MHz equipped with a TCI-cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | potassium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz equipped with cryogenically cooled probe (CPTXI)
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity | natural abundance | 1 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | potassium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz equipped with cryogenically cooled probe (CPTXI)
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity | natural abundance | 1 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | potassium chloride | natural abundance | 150 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19977_2mpf.nef |
Input source #2: Coordindates | 2mpf.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---520-------530-------540-------550-------560-------570-------580-------590-------600-------610---- GPSSPMELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPSSPMELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---620-------630-------640-------650-------660-------670-- RGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH -------110-------120-------130-------140-------150--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 158 | 0 | 0 | 100.0 |
Content subtype: combined_19977_2mpf.nef
Assigned chemical shifts
---520-------530-------540-------550-------560-------570-------580-------590-------600-------610---- GPSSPMELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLT |||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PSSPMELNGPLREEIVNF..RKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLT ---620-------630-------640-------650-------660-------670-- RGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH |||| |||||||||||||||||||||||||||||||||||||||||||||| ||||| RGRR.ASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGK..SILLH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
523 | ASN | CG | 176.659 |
547 | ASN | CG | 176.97 |
551 | ASN | CG | 176.844 |
566 | GLN | CD | 180.161 |
596 | ASN | CG | 177.459 |
637 | ASN | CG | 175.552 |
639 | ASN | CG | 175.907 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 982 | 927 | 94.4 |
13C chemical shifts | 736 | 617 | 83.8 |
15N chemical shifts | 174 | 149 | 85.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 320 | 302 | 94.4 |
13C chemical shifts | 316 | 283 | 89.6 |
15N chemical shifts | 151 | 139 | 92.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 662 | 625 | 94.4 |
13C chemical shifts | 420 | 334 | 79.5 |
15N chemical shifts | 23 | 10 | 43.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 95 | 93 | 97.9 |
13C chemical shifts | 95 | 89 | 93.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 68 | 93.2 |
13C chemical shifts | 73 | 1 | 1.4 |
Distance restraints
---520-------530-------540-------550-------560-------570-------580-------590-------600-------610---- GPSSPMELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLT |||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PSSPMELNGPLREEIVNF..RKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLT ---620-------630-------640-------650-------660-------670-- RGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH |||| |||||||||||||||||||||||||||||||||||||||||||||| ||||| RGRR.ASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGK..SILLH
Dihedral angle restraints
---520-------530-------540-------550-------560-------570-------580-------590-------600-------610---- GPSSPMELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLT |||||| ||||||||||||||||||||||||||||||||| ||||||||||||||||| |||||||| ||||||||||||| ||| .............EEIVNF.CRKLVASMPLFANADPNFVTAMLTKLKFEVFQP.DYIIREGTIGKKMYFIQ.GVVSVLTK.NKEMKLSDGSYFG...LLT ---520-------530-------540-------550-------560-------570-------580-------590-------600-------610---- ---620-------630-------640-------650-------660-------670-- RGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH |||||||||||||||||||||||||||||||||||||||||| |||||| RGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVA.DRLDRI ---620-------630-------640-------650-------660---