1H, 13C, 15N Resonance Assignment of the Chitin-Active Lytic Polysaccharide Monooxygenase BlLPMO10A from Bacillus licheniformis
HGFIEKPGSR AALCSEAFGF LNLNCGSVMY EPQSLEAKKG FPHSGPADGQ IASAGGLFGG ILDQQSENRW FKHIMTGGEH TFTWTYTAPH NTSQWHYYIT KKGWDPDKPL KRADFELIGA VPHDGSPASR NLSHHIYIPE DRLGYHVILA VWDVADTENA FYQVIDVDLV NK
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS14:SG | 1:CYS25:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.5 % (1780 of 1988) | 89.1 % (913 of 1025) | 88.1 % (690 of 783) | 98.3 % (177 of 180) |
Backbone | 99.2 % (1004 of 1012) | 98.6 % (346 of 351) | 99.6 % (497 of 499) | 99.4 % (161 of 162) |
Sidechain | 82.3 % (931 of 1131) | 84.1 % (567 of 674) | 79.3 % (348 of 439) | 88.9 % (16 of 18) |
Aromatic | 51.2 % (126 of 246) | 66.7 % (82 of 123) | 33.1 % (39 of 118) | 100.0 % (5 of 5) |
Methyl | 98.2 % (161 of 164) | 98.8 % (81 of 82) | 97.6 % (80 of 82) |
1. BlLPMO10A
HGFIEKPGSR AALCSEAFGF LNLNCGSVMY EPQSLEAKKG FPHSGPADGQ IASAGGLFGG ILDQQSENRW FKHIMTGGEH TFTWTYTAPH NTSQWHYYIT KKGWDPDKPL KRADFELIGA VPHDGSPASR NLSHHIYIPE DRLGYHVILA VWDVADTENA FYQVIDVDLV NKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BlLPMO10A | [U-98% 13C; U-98% 15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
3 | sodium chloride | natural abundance | 10 (±0.1) mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | BlLPMO10A | [U-98% 13C; U-98% 15N] | 1.0 ~ 1.5 mM | |
7 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
8 | sodium chloride | natural abundance | 10 (±0.1) mM | |
9 | D2O | natural abundance | 100 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | BlLPMO10A | natural abundance | 1.0 ~ 1.5 mM | |
11 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
12 | sodium chloride | natural abundance | 10 (±0.1) mM | |
13 | D2O | natural abundance | 10 % | |
14 | H2O | natural abundance | 90 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | BlLPMO10A | natural abundance | 1.0 ~ 1.5 mM | |
16 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
17 | sodium chloride | natural abundance | 10 (±0.1) mM | |
18 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | internal | direct | 1.0 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | na | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | internal | direct | 1.0 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | na | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | internal | direct | 1.0 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | na | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | internal | direct | 1.0 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | na | indirect | 0.101329 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BlLPMO10A | [U-98% 13C; U-98% 15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
3 | sodium chloride | natural abundance | 10 (±0.1) mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BlLPMO10A | [U-98% 13C; U-98% 15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
3 | sodium chloride | natural abundance | 10 (±0.1) mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BlLPMO10A | [U-98% 13C; U-98% 15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
3 | sodium chloride | natural abundance | 10 (±0.1) mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BlLPMO10A | [U-98% 13C; U-98% 15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
3 | sodium chloride | natural abundance | 10 (±0.1) mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BlLPMO10A | [U-98% 13C; U-98% 15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
3 | sodium chloride | natural abundance | 10 (±0.1) mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BlLPMO10A | [U-98% 13C; U-98% 15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
3 | sodium chloride | natural abundance | 10 (±0.1) mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BlLPMO10A | [U-98% 13C; U-98% 15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
3 | sodium chloride | natural abundance | 10 (±0.1) mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BlLPMO10A | [U-98% 13C; U-98% 15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
3 | sodium chloride | natural abundance | 10 (±0.1) mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BlLPMO10A | [U-98% 13C; U-98% 15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
3 | sodium chloride | natural abundance | 10 (±0.1) mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BlLPMO10A | [U-98% 13C; U-98% 15N] | 1.0 ~ 1.5 mM | |
2 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
3 | sodium chloride | natural abundance | 10 (±0.1) mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | BlLPMO10A | natural abundance | 1.0 ~ 1.5 mM | |
16 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
17 | sodium chloride | natural abundance | 10 (±0.1) mM | |
18 | D2O | natural abundance | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | BlLPMO10A | [U-98% 13C; U-98% 15N] | 1.0 ~ 1.5 mM | |
7 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
8 | sodium chloride | natural abundance | 10 (±0.1) mM | |
9 | D2O | natural abundance | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | BlLPMO10A | natural abundance | 1.0 ~ 1.5 mM | |
11 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
12 | sodium chloride | natural abundance | 10 (±0.1) mM | |
13 | D2O | natural abundance | 10 % | |
14 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | BlLPMO10A | natural abundance | 1.0 ~ 1.5 mM | |
11 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
12 | sodium chloride | natural abundance | 10 (±0.1) mM | |
13 | D2O | natural abundance | 10 % | |
14 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | BlLPMO10A | natural abundance | 1.0 ~ 1.5 mM | |
11 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
12 | sodium chloride | natural abundance | 10 (±0.1) mM | |
13 | D2O | natural abundance | 10 % | |
14 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | BlLPMO10A | natural abundance | 1.0 ~ 1.5 mM | |
16 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
17 | sodium chloride | natural abundance | 10 (±0.1) mM | |
18 | D2O | natural abundance | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | BlLPMO10A | natural abundance | 1.0 ~ 1.5 mM | |
16 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
17 | sodium chloride | natural abundance | 10 (±0.1) mM | |
18 | D2O | natural abundance | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | BlLPMO10A | natural abundance | 1.0 ~ 1.5 mM | |
16 | sodium phosphate | natural abundance | 25 (±0.1) mM | |
17 | sodium chloride | natural abundance | 10 (±0.1) mM | |
18 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19984_5lw4.nef |
Input source #2: Coordindates | 5lw4.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:14:CYS:SG | A:25:CYS:SG | oxidized, CA 58.0, CB 42.8 ppm | oxidized, CA 57.7, CB 46.0 ppm | 2.026 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 HGFIEKPGSRAALCSEAFGFLNLNCGSVMYEPQSLEAKKGFPHSGPADGQIASAGGLFGGILDQQSENRWFKHIMTGGEHTFTWTYTAPHNTSQWHYYIT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HGFIEKPGSRAALCSEAFGFLNLNCGSVMYEPQSLEAKKGFPHSGPADGQIASAGGLFGGILDQQSENRWFKHIMTGGEHTFTWTYTAPHNTSQWHYYIT -------110-------120-------130-------140-------150-------160-------170-- KKGWDPDKPLKRADFELIGAVPHDGSPASRNLSHHIYIPEDRLGYHVILAVWDVADTENAFYQVIDVDLVNK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| KKGWDPDKPLKRADFELIGAVPHDGSPASRNLSHHIYIPEDRLGYHVILAVWDVADTENAFYQVIDVDLVNK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 172 | 0 | 0 | 100.0 |
Content subtype: combined_19984_5lw4.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 HGFIEKPGSRAALCSEAFGFLNLNCGSVMYEPQSLEAKKGFPHSGPADGQIASAGGLFGGILDQQSENRWFKHIMTGGEHTFTWTYTAPHNTSQWHYYIT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HGFIEKPGSRAALCSEAFGFLNLNCGSVMYEPQSLEAKKGFPHSGPADGQIASAGGLFGGILDQQSENRWFKHIMTGGEHTFTWTYTAPHNTSQWHYYIT -------110-------120-------130-------140-------150-------160-------170-- KKGWDPDKPLKRADFELIGAVPHDGSPASRNLSHHIYIPEDRLGYHVILAVWDVADTENAFYQVIDVDLVNK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| KKGWDPDKPLKRADFELIGAVPHDGSPASRNLSHHIYIPEDRLGYHVILAVWDVADTENAFYQVIDVDLVNK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1025 | 907 | 88.5 |
13C chemical shifts | 783 | 675 | 86.2 |
15N chemical shifts | 185 | 177 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 351 | 350 | 99.7 |
13C chemical shifts | 344 | 343 | 99.7 |
15N chemical shifts | 162 | 161 | 99.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 674 | 557 | 82.6 |
13C chemical shifts | 439 | 332 | 75.6 |
15N chemical shifts | 23 | 16 | 69.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 84 | 81 | 96.4 |
13C chemical shifts | 84 | 80 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 123 | 71 | 57.7 |
13C chemical shifts | 118 | 23 | 19.5 |
15N chemical shifts | 5 | 5 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 HGFIEKPGSRAALCSEAFGFLNLNCGSVMYEPQSLEAKKGFPHSGPADGQIASAGGLFGGILDQQSENRWFKHIMTGGEHTFTWTYTAPHNTSQWHYYIT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||| HGFIEKPGSRAALCSEAFGFLNLNCGSVMYEPQSLEAKKGFPHSGPADGQIASAGGLFGGILDQQSENRWFKHIMTGGEHTFTWTYTA.HNTSQWHYYIT -------110-------120-------130-------140-------150-------160-------170-- KKGWDPDKPLKRADFELIGAVPHDGSPASRNLSHHIYIPEDRLGYHVILAVWDVADTENAFYQVIDVDLVNK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| KKGWDPDKPLKRADFELIGAVPHDGSPASRNLSHHIYIPEDRLGYHVILAVWDVADTENAFYQVIDVDLVNK
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 HGFIEKPGSRAALCSEAFGFLNLNCGSVMYEPQSLEAKKGFPHSGPADGQIASAGGLFGGILDQQSENRWFKHIMTGGEHTFTWTYTAPHNTSQWHYYIT |||| ||||||||||||||||| ||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GFIE..GSRAALCSEAFGFLNLN.GSVMYEPQSLEAKKGFP.SGPADGQIASAGGLFGGILDQQSENRWFKHIMTGGEHTFTWTYTAPHNTSQWHYYIT -------110-------120-------130-------140-------150-------160-------170-- KKGWDPDKPLKRADFELIGAVPHDGSPASRNLSHHIYIPEDRLGYHVILAVWDVADTENAFYQVIDVDLVNK |||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||| KKGWDPDKPLKRADFELIGAVPHD..PASRNLSHHIYIPEDRLGYHVILAVWDVADTENAFYQVIDVDLVNK