Solution structure of the PR domain of FOG-1
PWSGPEELEL ALQDGQRCVR ARLSLTEGLS WGPFYGSIQT RALSPEREEP GPAVTLMVDE SCWLRMLPQV LTEEAANSEI YRKDDALWCR VTKVVPSGGL LYVRLVTEPH GAPRHPVQEP VEPGGLA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.3 % (1220 of 1447) | 82.5 % (623 of 755) | 85.4 % (485 of 568) | 90.3 % (112 of 124) |
Backbone | 91.4 % (673 of 736) | 91.3 % (230 of 252) | 91.1 % (337 of 370) | 93.0 % (106 of 114) |
Sidechain | 79.1 % (654 of 827) | 78.1 % (393 of 503) | 81.2 % (255 of 314) | 60.0 % (6 of 10) |
Aromatic | 81.1 % (73 of 90) | 91.1 % (41 of 45) | 68.3 % (28 of 41) | 100.0 % (4 of 4) |
Methyl | 86.3 % (126 of 146) | 94.5 % (69 of 73) | 78.1 % (57 of 73) |
1. FOG-1 PR
PWSGPEELEL ALQDGQRCVR ARLSLTEGLS WGPFYGSIQT RALSPEREEP GPAVTLMVDE SCWLRMLPQV LTEEAANSEI YRKDDALWCR VTKVVPSGGL LYVRLVTEPH GAPRHPVQEP VEPGGLASolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FOG-1 PR | natural abundance | 0.5-1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DSS | natural abundance | 0.01 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | FOG-1 PR | [U-100% 15N] | 0.5-1 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | DSS | natural abundance | 0.01 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | FOG-1 PR | [U-100% 13C; U-100% 15N] | 0.5-1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | DSS | natural abundance | 0.01 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | FOG-1 PR | [U-100% 15N] | 0.5-1 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | DSS | natural abundance | 0.01 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FOG-1 PR | natural abundance | 0.5-1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DSS | natural abundance | 0.01 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | FOG-1 PR | [U-100% 13C; U-100% 15N] | 0.5-1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | DSS | natural abundance | 0.01 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | FOG-1 PR | [U-100% 13C; U-100% 15N] | 0.5-1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | DSS | natural abundance | 0.01 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | FOG-1 PR | [U-100% 13C; U-100% 15N] | 0.5-1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | DSS | natural abundance | 0.01 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | FOG-1 PR | [U-100% 13C; U-100% 15N] | 0.5-1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | DSS | natural abundance | 0.01 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | FOG-1 PR | [U-100% 13C; U-100% 15N] | 0.5-1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | DSS | natural abundance | 0.01 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | FOG-1 PR | [U-100% 13C; U-100% 15N] | 0.5-1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | DSS | natural abundance | 0.01 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | FOG-1 PR | [U-100% 13C; U-100% 15N] | 0.5-1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | DSS | natural abundance | 0.01 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | FOG-1 PR | [U-100% 13C; U-100% 15N] | 0.5-1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | DSS | natural abundance | 0.01 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | FOG-1 PR | [U-100% 13C; U-100% 15N] | 0.5-1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | DSS | natural abundance | 0.01 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | FOG-1 PR | [U-100% 13C; U-100% 15N] | 0.5-1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | DSS | natural abundance | 0.01 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | FOG-1 PR | [U-100% 13C; U-100% 15N] | 0.5-1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | DSS | natural abundance | 0.01 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5-1 mM in 20 mM Na2HPO4/NaH2PO4, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | FOG-1 PR | [U-100% 13C; U-100% 15N] | 0.5-1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | DSS | natural abundance | 0.01 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19988_2mpl.nef |
Input source #2: Coordindates | 2mpl.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
100-----110-------120-------130-------140-------150-------160-------170-------180-------190-------20 PWSGPEELELALQDGQRCVRARLSLTEGLSWGPFYGSIQTRALSPEREEPGPAVTLMVDESCWLRMLPQVLTEEAANSEIYRKDDALWCRVTKVVPSGGL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PWSGPEELELALQDGQRCVRARLSLTEGLSWGPFYGSIQTRALSPEREEPGPAVTLMVDESCWLRMLPQVLTEEAANSEIYRKDDALWCRVTKVVPSGGL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------210-------220------ LYVRLVTEPHGAPRHPVQEPVEPGGLA ||||||||||||||||||||||||||| LYVRLVTEPHGAPRHPVQEPVEPGGLA -------110-------120-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 127 | 0 | 0 | 100.0 |
Content subtype: combined_19988_2mpl.nef
Assigned chemical shifts
100-----110-------120-------130-------140-------150-------160-------170-------180-------190-------20 PWSGPEELELALQDGQRCVRARLSLTEGLSWGPFYGSIQTRALSPEREEPGPAVTLMVDESCWLRMLPQVLTEEAANSEIYRKDDALWCRVTKVVPSGGL || ||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||| PW..PEELELALQDGQRCVRARLSLTEGLSWGPFYGSIQTRALSPER..PGPAVTLMVDESCWLRMLPQVLTEEAANSEIYRKDDALWCRVTKVVPSGGL 0-------210-------220------ LYVRLVTEPHGAPRHPVQEPVEPGGLA |||||||| || |||||||| LYVRLVTE..GA.......PVEPGGLA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 755 | 606 | 80.3 |
13C chemical shifts | 568 | 474 | 83.5 |
15N chemical shifts | 134 | 109 | 81.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 252 | 225 | 89.3 |
13C chemical shifts | 254 | 225 | 88.6 |
15N chemical shifts | 114 | 103 | 90.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 503 | 381 | 75.7 |
13C chemical shifts | 314 | 249 | 79.3 |
15N chemical shifts | 20 | 6 | 30.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 75 | 67 | 89.3 |
13C chemical shifts | 75 | 56 | 74.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 45 | 41 | 91.1 |
13C chemical shifts | 41 | 28 | 68.3 |
15N chemical shifts | 4 | 4 | 100.0 |
Distance restraints
100-----110-------120-------130-------140-------150-------160-------170-------180-------190-------20 PWSGPEELELALQDGQRCVRARLSLTEGLSWGPFYGSIQTRALSPEREEPGPAVTLMVDESCWLRMLPQVLTEEAANSEIYRKDDALWCRVTKVVPSGGL | ||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||| .W..PEELELALQDGQRCVRARLSLTEGLSWGPFYGSIQTRALSPER..PGPAVTLMVDESCWLRMLPQVLTEEAANSEIYRKDDALWCRVTKVVPSGGL 0-------210-------220------ LYVRLVTEPHGAPRHPVQEPVEPGGLA |||||||| || ||| || LYVRLVTE..GA.......PVE...LA
Dihedral angle restraints
100-----110-------120-------130-------140-------150-------160-------170-------180-------190-------20 PWSGPEELELALQDGQRCVRARLSLTEGLSWGPFYGSIQTRALSPEREEPGPAVTLMVDESCWLRMLPQVLTEEAANSEIYRKDDALWCRVTKVVPSGGL |||||||||||||||||||||||||||||||||||||| ||||| ||||||||||||||||||||||||||||||||||||||||||||||||||| ...GPEELELALQDGQRCVRARLSLTEGLSWGPFYGSIQTR.LSPER..PGPAVTLMVDESCWLRMLPQVLTEEAANSEIYRKDDALWCRVTKVVPSGGL 100-----110-------120-------130-------140-------150-------160-------170-------180-------190-------20 0-------210-------220------ LYVRLVTEPHGAPRHPVQEPVEPGGLA ||||||||| ||| LYVRLVTEP.........EPV 0-------210-------220