Structural Characterization of the Hypertrophic Cardiomyopathy-Related R502W Mutant of the C3 Domain of Cardiac Myosin Binding Protein-C
GSHMPVLITR PLEDQLVMVG QRVEFECEVS EEGAQVKWLK DGVELTREET FKYWFKKDGQ RHHLIINEAM LEDAGHYALC TSGGQALAEL IVQEK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.7 % (993 of 1119) | 95.2 % (554 of 582) | 78.2 % (340 of 435) | 97.1 % (99 of 102) |
Backbone | 82.7 % (468 of 566) | 94.9 % (186 of 196) | 69.3 % (192 of 277) | 96.8 % (90 of 93) |
Sidechain | 95.5 % (611 of 640) | 95.3 % (368 of 386) | 95.5 % (234 of 245) | 100.0 % (9 of 9) |
Aromatic | 83.7 % (72 of 86) | 83.7 % (36 of 43) | 82.9 % (34 of 41) | 100.0 % (2 of 2) |
Methyl | 100.0 % (108 of 108) | 100.0 % (54 of 54) | 100.0 % (54 of 54) |
1. entity
GSHMPVLITR PLEDQLVMVG QRVEFECEVS EEGAQVKWLK DGVELTREET FKYWFKKDGQ RHHLIINEAM LEDAGHYALC TSGGQALAEL IVQEKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013292 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013292 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013292 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_25010_2mq3.nef |
Input source #2: Coordindates | 2mq3.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-450-----460-------470-------480-------490-------500-------510-------520-------530-------540--- GSHMPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYWFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYWFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEK --------10--------20--------30--------40--------50--------60--------70--------80--------90-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 95 | 0 | 0 | 100.0 |
Content subtype: combined_25010_2mq3.nef
Assigned chemical shifts
-450-----460-------470-------480-------490-------500-------510-------520-------530-------540--- GSHMPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYWFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..HMPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYWFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 582 | 553 | 95.0 |
13C chemical shifts | 435 | 317 | 72.9 |
15N chemical shifts | 106 | 100 | 94.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 196 | 188 | 95.9 |
13C chemical shifts | 190 | 92 | 48.4 |
15N chemical shifts | 93 | 89 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 386 | 365 | 94.6 |
13C chemical shifts | 245 | 225 | 91.8 |
15N chemical shifts | 13 | 11 | 84.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 57 | 100.0 |
13C chemical shifts | 57 | 55 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 43 | 33 | 76.7 |
13C chemical shifts | 41 | 27 | 65.9 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
-450-----460-------470-------480-------490-------500-------510-------520-------530-------540--- GSHMPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYWFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEK |||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....PVLITRPLEDQLVMVGQRVEFECEVSEE.AQVKWLKDGVELTREETFKYWFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEK