NMR structure of the hypotheical protein Lreu_0056 from Lactobacillus reuteri
GHMKFTDQQI GVLAGLAISP EWLKQNIAAN QLVYGIVKPS DTVPAGVDDY SYLVAADDQD GTIIFFKAEG QTVIIKYTSQ RNTKLKAKAL TLSQLKKEFY QTRSQKREVD DYVAGLRTE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.6 % (1270 of 1401) | 97.7 % (709 of 726) | 80.0 % (436 of 545) | 96.2 % (125 of 130) |
Backbone | 83.6 % (592 of 708) | 97.5 % (237 of 243) | 69.9 % (244 of 349) | 95.7 % (111 of 116) |
Sidechain | 98.0 % (788 of 804) | 97.7 % (472 of 483) | 98.4 % (302 of 307) | 100.0 % (14 of 14) |
Aromatic | 94.2 % (98 of 104) | 94.2 % (49 of 52) | 94.1 % (48 of 51) | 100.0 % (1 of 1) |
Methyl | 100.0 % (148 of 148) | 100.0 % (74 of 74) | 100.0 % (74 of 74) |
1. entity
GHMKFTDQQI GVLAGLAISP EWLKQNIAAN QLVYGIVKPS DTVPAGVDDY SYLVAADDQD GTIIFFKAEG QTVIIKYTSQ RNTKLKAKAL TLSQLKKEFY QTRSQKREVD DYVAGLRTESolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_25028_2mqd.nef |
Input source #2: Coordindates | 2mqd.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-20-------30--------40--------50--------60--------70--------80--------90-------100-------110-------1 GHMKFTDQQIGVLAGLAISPEWLKQNIAANQLVYGIVKPSDTVPAGVDDYSYLVAADDQDGTIIFFKAEGQTVIIKYTSQRNTKLKAKALTLSQLKKEFY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMKFTDQQIGVLAGLAISPEWLKQNIAANQLVYGIVKPSDTVPAGVDDYSYLVAADDQDGTIIFFKAEGQTVIIKYTSQRNTKLKAKALTLSQLKKEFY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 20-------130------- QTRSQKREVDDYVAGLRTE ||||||||||||||||||| QTRSQKREVDDYVAGLRTE -------110---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 119 | 0 | 0 | 100.0 |
Content subtype: combined_25028_2mqd.nef
Assigned chemical shifts
-20-------30--------40--------50--------60--------70--------80--------90-------100-------110-------1 GHMKFTDQQIGVLAGLAISPEWLKQNIAANQLVYGIVKPSDTVPAGVDDYSYLVAADDQDGTIIFFKAEGQTVIIKYTSQRNTKLKAKALTLSQLKKEFY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMKFTDQQIGVLAGLAISPEWLKQNIAANQLVYGIVKPSDTVPAGVDDYSYLVAADDQDGTIIFFKAEGQTVIIKYTSQRNTKLKAKALTLSQLKKEFY 20-------130------- QTRSQKREVDDYVAGLRTE ||||||||||||||||||| QTRSQKREVDDYVAGLRTE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 726 | 709 | 97.7 |
13C chemical shifts | 545 | 419 | 76.9 |
15N chemical shifts | 134 | 125 | 93.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 243 | 237 | 97.5 |
13C chemical shifts | 238 | 117 | 49.2 |
15N chemical shifts | 116 | 111 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 483 | 472 | 97.7 |
13C chemical shifts | 307 | 302 | 98.4 |
15N chemical shifts | 18 | 14 | 77.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 75 | 75 | 100.0 |
13C chemical shifts | 75 | 75 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 49 | 94.2 |
13C chemical shifts | 51 | 48 | 94.1 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-20-------30--------40--------50--------60--------70--------80--------90-------100-------110-------1 GHMKFTDQQIGVLAGLAISPEWLKQNIAANQLVYGIVKPSDTVPAGVDDYSYLVAADDQDGTIIFFKAEGQTVIIKYTSQRNTKLKAKALTLSQLKKEFY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..MKFTDQQIGVLAGLAISPEWLKQNIAANQLVYGIVKPSDTVPAGVDDYSYLVAADDQDGTIIFFKAEGQTVIIKYTSQRNTKLKAKALTLSQLKKEFY 20-------130------- QTRSQKREVDDYVAGLRTE ||||||||||||||||||| QTRSQKREVDDYVAGLRTE