BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	86.3 % (1003 of 1162)	94.0 % (562 of 598)	74.3 % (339 of 456)	94.4 % (102 of 108)
Backbone	83.3 % (513 of 616)	98.1 % (206 of 210)	68.8 % (212 of 308)	96.9 % (95 of 98)
Sidechain	90.8 % (585 of 644)	91.8 % (356 of 388)	90.2 % (222 of 246)	70.0 % (7 of 10)
Aromatic	85.4 % (70 of 82)	100.0 % (41 of 41)	70.7 % (29 of 41)
Methyl	100.0 % (120 of 120)	100.0 % (60 of 60)	100.0 % (60 of 60)

1. entity

GENYDDPHKT PASPVVHIRG LIDGVVEADL VEALQEFGPI SYVVVMPKKR QALVEFEDVL GACNAVNYAA DNQIYIAGHP AFVNYSTSQK ISRPGDSDDS RSVNS

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.15 K, pH 6.5, Details pH 6.5

#	Name	Isotope labeling	Concentration
1	entity	[U-100% 15N]	1-2 mM
2	sodium chloride	natural abundance	60 mM
3	sodium phosphate	natural abundance	40 mM
4	DTT	natural abundance	1 mM
5	H2O	natural abundance	90 %
6	D2O	natural abundance	10 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
7	entity	[U-100% 13C; U-100% 15N]	1-2 mM
8	sodium chloride	natural abundance	60 mM
9	sodium phosphate	natural abundance	40 mM
10	DTT	natural abundance	1 mM
11	H2O	natural abundance	90 %
12	D2O	natural abundance	10 %

Sample #3

Solvent system 100% D2O, Pressure 1 atm, Temperature 310.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
13	entity	[U-100% 15N]	1-2 mM
14	sodium chloride	natural abundance	60 mM
15	sodium phosphate	natural abundance	40 mM
16	DTT	natural abundance	1 mM
17	D2O	natural abundance	100 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.2 ppm, Outliers: 3 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.2 ppm, Outliers: 3 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.03 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2MQL, Strand ID: A Detail

Release date

2015-05-03

Related entities 1. hnRNP L, : 1 : 6 : 1 : 78 entities Detail

Interaction partners 1. hnRNP L, : 28 interactors Detail

More details for 28 interactors identified by 7 citations

Experiments performed 4 experiments Detail

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints	combined_25038_2mql.nef
Input source #2: Coordindates	2mql.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

-----90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
GENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDS
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDS
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100

-----
RSVNS
|||||
RSVNS
-----

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	105	0	0	100.0

Content subtype: combined_25038_2mql.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	976		100.0 (chain: A, length: 105)
1	Distance restraints	DYANA/DIANA_distance_constraints_2	OK	3286 (1)	noe	95.2 (chain: A, length: 105)
2	Distance restraints	DYANA/DIANA_distance_constraints_3	Warning	56 (1)	hbond	19.0 (chain: A, length: 105)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 105, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 555
  - ¹³C chemical shifts: 318
  - ¹⁵N chemical shifts: 103
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	598	555	92.8
¹³C chemical shifts	456	318	69.7
¹⁵N chemical shifts	112	103	92.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	210	204	97.1
¹³C chemical shifts	210	103	49.0
¹⁵N chemical shifts	98	94	95.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	388	351	90.5
¹³C chemical shifts	246	215	87.4
¹⁵N chemical shifts	14	9	64.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	61	61	100.0
¹³C chemical shifts	61	61	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	41	41	100.0
¹³C chemical shifts	41	25	61.0

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 105, Sequence coverage: 95.2%
- Total number of restraints: 3284
- Weight of restraints: 1.0 (3284)
- Potential type of restraints: upper-bound-parabolic (3284)
- Range of distance target values: 3.51, 6.0 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: DYANA/DIANA_distance_constraints_3
  - Status: Warning
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 105, Sequence coverage: 19.0%
  - Total number of restraints: 56
  - Weight of restraints: 1.0 (56)
  - Potential type of restraints: upper-bound-parabolic (56)
  - Range of distance target values: 1.8, 3.4 (Å)
  - Histogram of distance target values
  - Histogram of discrepancy in distance target values
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map

Keywords Protein, RRM

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (7.582 seconds)

BMRB: 25038

Sample #1

Sample #2

Sample #3

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. hnRNP L, : 1 : 6 : 1 : 78 entities Detail

Interaction partners 1. hnRNP L, : 28 interactors Detail

Experiments performed 4 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 4 contents Detail