BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	86.0 % (1164 of 1353)	94.2 % (661 of 702)	72.2 % (377 of 522)	97.7 % (126 of 129)
Backbone	82.0 % (571 of 696)	96.6 % (229 of 237)	66.9 % (232 of 347)	98.2 % (110 of 112)
Sidechain	91.1 % (700 of 768)	92.9 % (432 of 465)	88.1 % (252 of 286)	94.1 % (16 of 17)
Aromatic	80.4 % (74 of 92)	100.0 % (46 of 46)	60.0 % (27 of 45)	100.0 % (1 of 1)
Methyl	97.0 % (128 of 132)	97.0 % (64 of 66)	97.0 % (64 of 66)

1. entity

QKISRPGDSD DSRSVNSVLL FTILNPIYSI TTDVLYTICN PCGPVQRIVI FRKNGVQAMV EFDSVQSAQR AKASLNGADI YSGCCTLKIE YAKPTRLNVF KNDQDTWDYT NPNLSGQG

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
1	entity	[U-100% 15N]	1.0 ~ 2.0 mM
2	sodium chloride	natural abundance	60 mM
3	sodium phosphate	natural abundance	40 mM
4	DTT	natural abundance	1 mM
5	D2O	natural abundance	10 %
6	H2O	natural abundance	90 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
7	entity	[U-100% 13C; U-100% 15N]	1.0 ~ 2.0 mM
8	sodium chloride	natural abundance	60 mM
9	sodium phosphate	natural abundance	40 mM
10	DTT	natural abundance	1 mM
11	D2O	natural abundance	10 %
12	H2O	natural abundance	90 %

Sample #3

Solvent system 100% D2O, Pressure 1 atm, Temperature 310.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
13	entity	[U-100% 15N]	1.0 ~ 2.0 mM
14	sodium chloride	natural abundance	60 mM
15	sodium phosphate	natural abundance	40 mM
16	DTT	natural abundance	1 mM
17	D2O	natural abundance	100 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.13 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.13 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.12 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2MQM, Strand ID: A Detail

Release date

2015-05-03

Citation

Protein-protein interaction among hnRNPs shuttling between nucleus and cytoplasm
Blatter, M., Allain, F.
J. Mol. Biol. (2000), 298, 395-405, PubMed 10772858 , DOI 10.1006/jmbi.2000.3687 , Abstract

Related entities 1. Second RNA Recognition Motif Domain of hnRNP L, : 1 : 7 : 1 : 95 entities Detail

Interaction partners 1. Second RNA Recognition Motif Domain of hnRNP L, : 92 interactors Detail

More details for 92 interactors identified by 27 citations

Experiments performed 4 experiments Detail

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints	combined_25039_2mqm.nef
Input source #2: Coordindates	2mqm.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

----180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
QKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVF
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
QKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVF
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100

----280-------290-
KNDQDTWDYTNPNLSGQG
||||||||||||||||||
KNDQDTWDYTNPNLSGQG
-------110--------

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	118	0	0	100.0

Content subtype: combined_25039_2mqm.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	1157		100.0 (chain: A, length: 118)
1	Distance restraints	DYANA/DIANA_distance_constraints_2	OK	3633 (1)	noe	95.8 (chain: A, length: 118)
2	Distance restraints	DYANA/DIANA_distance_constraints_3	Warning	148 (1)	hbond	42.4 (chain: A, length: 118)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 118, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 662
  - ¹³C chemical shifts: 366
  - ¹⁵N chemical shifts: 129
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
225	ARG	HH11	6.988
225	ARG	NH1	70.411

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	702	661	94.2
¹³C chemical shifts	522	366	70.1
¹⁵N chemical shifts	135	128	94.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	237	231	97.5
¹³C chemical shifts	236	114	48.3
¹⁵N chemical shifts	112	110	98.2

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	465	430	92.5
¹³C chemical shifts	286	252	88.1
¹⁵N chemical shifts	23	18	78.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	67	65	97.0
¹³C chemical shifts	67	65	97.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	46	46	100.0
¹³C chemical shifts	45	27	60.0
¹⁵N chemical shifts	1	1	100.0

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 118, Sequence coverage: 95.8%
- Total number of restraints: 3631
- Weight of restraints: 1.0 (3631)
- Potential type of restraints: upper-bound-parabolic (3631)
- Range of distance target values: 3.28, 6.0 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: DYANA/DIANA_distance_constraints_3
  - Status: Warning
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 118, Sequence coverage: 42.4%
  - Total number of restraints: 148
  - Weight of restraints: 1.0 (148)
  - Potential type of restraints: upper-bound-parabolic (148)
  - Range of distance target values: 1.8, 3.4 (Å)
  - Histogram of distance target values
  - Histogram of discrepancy in distance target values
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map

Keywords Protein, RRM

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (6.619 seconds)

BMRB: 25039

Sample #1

Sample #2

Sample #3

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. Second RNA Recognition Motif Domain of hnRNP L, : 1 : 7 : 1 : 95 entities Detail

Interaction partners 1. Second RNA Recognition Motif Domain of hnRNP L, : 92 interactors Detail

Experiments performed 4 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 4 contents Detail