BMRBj - BMREntryMaster

Found 1 Document (1.045 seconds)

BMRB: 25043

2MQQ

Structural Investigation of hnRNP L bound to RNA

Authors

Blatter, M., Allain, F.

Assembly

Most two C-terminal RNA Recognition Motif Domain of hnRNP L bound to two equivalents ACACA RNA

Entity

1. Most two C-terminal RNA Recognition Motif Domain of hnRNP L bound to two equivalents ACACA RNA, entity 1 (polymer), 215 monomers, 24113.00 Da Detail

YGPHADSPVL MVYGLDQSKM NCDRVFNVFC LYGNVEKVKF MKSKPGAAMV EMADGYAVDR AITHLNNNFM FGQKMNVCVS KQPAIMPGQS YGLEDGSCSY KDFSESRNNR FSTPEQAAKN RIQHPSNVLH FFNAPLEVTE ENFFEICDEL GVKRPTSVKV FSGKSERSSS GLLEWDSKSD ALETLGFLNH YQMKNPNGPY PYTLKLCFST AQHAS

2. RNA (5'-R(*AP*CP*AP*CP*A)-3') (polymer), 5 monomers, 1615.996 × 2 Da Detail

ACACA

Total weight

27344.992 Da

Max. entity weight

24113.0 Da

Source organism

Rattus norvegicus

Exptl. method

solution NMR

Refine. method

simulated annealing

Data set

assigned_chemical_shifts

Chem. Shift Complete1

Sequence coverage: 97.3 %, Completeness: 82.6 %, Completeness (bb): 81.1 % Detail

Polymer type: polypeptide(L) polyribonucleotide

	Total	¹H	¹³C	¹⁵N
All	82.6 % (2134 of 2584)	89.9 % (1215 of 1351)	69.6 % (699 of 1005)	96.5 % (220 of 228)
Backbone	81.1 % (1071 of 1321)	91.1 % (421 of 462)	68.4 % (449 of 656)	99.0 % (201 of 203)
Sidechain	85.9 % (1258 of 1464)	89.3 % (794 of 889)	80.9 % (445 of 550)	76.0 % (19 of 25)
Aromatic	63.1 % (169 of 268)	80.6 % (108 of 134)	45.1 % (60 of 133)	100.0 % (1 of 1)
Methyl	97.7 % (172 of 176)	97.7 % (86 of 88)	97.7 % (86 of 88)

1. entity 1

2. RNA (5'-R(*AP*CP*AP*CP*A)-3')

ACACA

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
1	entity_1	[U-100% 15N]	1.5 mM
2	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
3	sodium chloride	natural abundance	60 mM
4	sodium phosphate	natural abundance	40 mM
5	DTT	natural abundance	1 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
8	entity_1	[U-100% 13C; U-100% 15N]	1.5 mM
9	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
10	sodium chloride	natural abundance	60 mM
11	sodium phosphate	natural abundance	40 mM
12	DTT	natural abundance	1 mM
13	H2O	natural abundance	90 %
14	D2O	natural abundance	10 %

Sample #3

Solvent system 100% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
15	entity_1	[U-100% 15N]	1.5 mM
16	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
17	sodium chloride	natural abundance	60 mM
18	sodium phosphate	natural abundance	40 mM
19	DTT	natural abundance	1 mM
20	D2O	natural abundance	100 %

Sample #4

Solvent system 100% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
21	entity_1	[U-100% 13C; U-100% 15N]	1.5 mM
22	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
23	sodium chloride	natural abundance	60 mM
24	sodium phosphate	natural abundance	40 mM
25	DTT	natural abundance	1 mM
26	D2O	natural abundance	100 %

Chem. Shift Complete2

Sequence coverage: 24.5 %, Completeness: 51.3 %, Completeness (bb): 51.9 % Detail

Polymer type: polypeptide(L) polyribonucleotide

	Total	¹H	¹³C	¹⁵N
All	51.3 % (2649 of 5168)	55.1 % (1490 of 2702)	44.4 % (893 of 2010)	58.3 % (266 of 456)
Backbone	51.9 % (1371 of 2642)	58.3 % (539 of 924)	44.9 % (589 of 1312)	59.9 % (243 of 406)
Sidechain	51.7 % (1514 of 2928)	53.5 % (951 of 1778)	49.1 % (540 of 1100)	46.0 % (23 of 50)
Aromatic	36.4 % (195 of 536)	44.8 % (120 of 268)	27.8 % (74 of 266)	50.0 % (1 of 2)
Methyl	59.9 % (211 of 352)	60.8 % (107 of 176)	59.1 % (104 of 176)

1. entity 1

2. RNA (5'-R(*AP*CP*AP*CP*A)-3')

ACACA

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
1	entity_1	[U-100% 15N]	1.5 mM
2	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
3	sodium chloride	natural abundance	60 mM
4	sodium phosphate	natural abundance	40 mM
5	DTT	natural abundance	1 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
8	entity_1	[U-100% 13C; U-100% 15N]	1.5 mM
9	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
10	sodium chloride	natural abundance	60 mM
11	sodium phosphate	natural abundance	40 mM
12	DTT	natural abundance	1 mM
13	H2O	natural abundance	90 %
14	D2O	natural abundance	10 %

Sample #3

Solvent system 100% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
15	entity_1	[U-100% 15N]	1.5 mM
16	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
17	sodium chloride	natural abundance	60 mM
18	sodium phosphate	natural abundance	40 mM
19	DTT	natural abundance	1 mM
20	D2O	natural abundance	100 %

Sample #4

Solvent system 100% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
21	entity_1	[U-100% 13C; U-100% 15N]	1.5 mM
22	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
23	sodium chloride	natural abundance	60 mM
24	sodium phosphate	natural abundance	40 mM
25	DTT	natural abundance	1 mM
26	D2O	natural abundance	100 %

Chem. Shift Complete3

Sequence coverage: 30.5 %, Completeness: 41.4 %, Completeness (bb): 43.6 % Detail

Polymer type: polypeptide(L) polyribonucleotide

	Total	¹H	¹³C	¹⁵N
All	41.4 % (3212 of 7752)	43.6 % (1767 of 4053)	37.2 % (1122 of 3015)	47.2 % (323 of 684)
Backbone	43.6 % (1727 of 3963)	48.2 % (668 of 1386)	38.6 % (759 of 1968)	49.3 % (300 of 609)
Sidechain	40.4 % (1773 of 4392)	41.2 % (1099 of 2667)	39.4 % (650 of 1650)	32.0 % (24 of 75)
Aromatic	28.2 % (227 of 804)	34.1 % (137 of 402)	22.3 % (89 of 399)	33.3 % (1 of 3)
Methyl	48.9 % (258 of 528)	48.9 % (129 of 264)	48.9 % (129 of 264)

1. entity 1

2. RNA (5'-R(*AP*CP*AP*CP*A)-3')

ACACA

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
1	entity_1	[U-100% 15N]	1.5 mM
2	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
3	sodium chloride	natural abundance	60 mM
4	sodium phosphate	natural abundance	40 mM
5	DTT	natural abundance	1 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
8	entity_1	[U-100% 13C; U-100% 15N]	1.5 mM
9	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
10	sodium chloride	natural abundance	60 mM
11	sodium phosphate	natural abundance	40 mM
12	DTT	natural abundance	1 mM
13	H2O	natural abundance	90 %
14	D2O	natural abundance	10 %

Sample #3

Solvent system 100% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
15	entity_1	[U-100% 15N]	1.5 mM
16	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
17	sodium chloride	natural abundance	60 mM
18	sodium phosphate	natural abundance	40 mM
19	DTT	natural abundance	1 mM
20	D2O	natural abundance	100 %

Sample #4

Solvent system 100% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
21	entity_1	[U-100% 13C; U-100% 15N]	1.5 mM
22	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
23	sodium chloride	natural abundance	60 mM
24	sodium phosphate	natural abundance	40 mM
25	DTT	natural abundance	1 mM
26	D2O	natural abundance	100 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 2.56 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 2.56 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.04 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2MQQ, Strand ID: A Detail

Release date

2015-12-20

Related entities 1. Most two C-terminal RNA Recognition Motif Domain of hnRNP L bound to two equivalents ACACA RNA, entity 1, : 1 : 6 : 2 : 2 : 54 entities Detail

Experiments performed 7 experiments Detail

1 3D 1H-15N NOESY

Instrument

Bruker Avance - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
1	entity_1	[U-100% 15N]	1.5 mM
2	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
3	sodium chloride	natural abundance	60 mM
4	sodium phosphate	natural abundance	40 mM
5	DTT	natural abundance	1 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

2 3D 1H-13C NOESY aliphatic

Instrument

Bruker Avance - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
8	entity_1	[U-100% 13C; U-100% 15N]	1.5 mM
9	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
10	sodium chloride	natural abundance	60 mM
11	sodium phosphate	natural abundance	40 mM
12	DTT	natural abundance	1 mM
13	H2O	natural abundance	90 %
14	D2O	natural abundance	10 %

3 3D 1H-13C NOESY aromatic

Instrument

Bruker Avance - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
8	entity_1	[U-100% 13C; U-100% 15N]	1.5 mM
9	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
10	sodium chloride	natural abundance	60 mM
11	sodium phosphate	natural abundance	40 mM
12	DTT	natural abundance	1 mM
13	H2O	natural abundance	90 %
14	D2O	natural abundance	10 %

4 2D 1H-1H NOESY

Instrument

Bruker Avance - 900 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
15	entity_1	[U-100% 15N]	1.5 mM
16	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
17	sodium chloride	natural abundance	60 mM
18	sodium phosphate	natural abundance	40 mM
19	DTT	natural abundance	1 mM
20	D2O	natural abundance	100 %

5 2D 1H-1H TOCSY

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
15	entity_1	[U-100% 15N]	1.5 mM
16	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
17	sodium chloride	natural abundance	60 mM
18	sodium phosphate	natural abundance	40 mM
19	DTT	natural abundance	1 mM
20	D2O	natural abundance	100 %

6 3D F3-filtered-F2-edited NOESY

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
21	entity_1	[U-100% 13C; U-100% 15N]	1.5 mM
22	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
23	sodium chloride	natural abundance	60 mM
24	sodium phosphate	natural abundance	40 mM
25	DTT	natural abundance	1 mM
26	D2O	natural abundance	100 %

7 2D F2-filtered NOESY

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 313.15 K, pH 6.5

#	Name	Isotope labeling	Concentration
21	entity_1	[U-100% 13C; U-100% 15N]	1.5 mM
22	RNA (5'-R(APCPAPCP*A)-3')	natural abundance	3.0 mM
23	sodium chloride	natural abundance	60 mM
24	sodium phosphate	natural abundance	40 mM
25	DTT	natural abundance	1 mM
26	D2O	natural abundance	100 %

NMR combined restraints 7 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_25043_2mqq.nef
Input source #2: Coordindates	2mqq.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-
YGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYGLEDGSCSY
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
YGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYGLEDGSCSY
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100

------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-
KDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPY
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
KDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPY
-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200

------580------
PYTLKLCFSTAQHAS
|||||||||||||||
PYTLKLCFSTAQHAS
-------210-----

Entity_assembly_ID (NMR): B vs Auth_asym_ID (model): B

-----
ACACA
|||||
ACACA

Entity_assembly_ID (NMR): C vs Auth_asym_ID (model): C

-----
ACACA
|||||
ACACA

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Sequence coverage (%)
A	A	215	100.0
B	B	5	100.0
C	C	5	100.0

Content subtype: combined_25043_2mqq.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	2053		99.5 (chain: A, length: 215)
2	Assigned chemical shifts	assigned_chem_shift_list_2	OK	74		100.0 (chain: B, length: 5)
3	Assigned chemical shifts	assigned_chem_shift_list_3	OK	72		100.0 (chain: B, length: 5)
1	Distance restraints	DYANA/DIANA_distance_constraints_2	Warning	6973 (1)	noe	99.1 (chain: A, length: 215), 100.0 (chain: B, length: 5), 20.0 (chain: C, length: 5)
2	Distance restraints	DYANA/DIANA_distance_constraints_4	Warning	284 (1)	hbond	44.7 (chain: A, length: 215)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_3	OK	78 (78)	.	36.7 (chain: A, length: 215), 100.0 (chain: B, length: 5)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 215, Sequence coverage: 99.5%
- Total number of assignments
  - ¹H chemical shifts: 1198
  - ¹³C chemical shifts: 632
  - ¹⁵N chemical shifts: 223
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A
Saveframe: assigned_chem_shift_list_2
- Status: OK
- Sequence coverage of experimental data
  - Entity_assembly_ID: B, Chain length: 5, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 40
  - ¹³C chemical shifts: 34
- Completeness of assignments
  - Entity_assemble_ID: B
- Histogram of normalized assigned chemical shifts
Saveframe: assigned_chem_shift_list_3
- Status: OK
- Sequence coverage of experimental data
  - Entity_assembly_ID: B, Chain length: 5, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 38
  - ¹³C chemical shifts: 34
- Completeness of assignments
  - Entity_assemble_ID: B
- Histogram of normalized assigned chemical shifts

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
525	ARG	HH11	6.468
525	ARG	HH12	6.468
525	ARG	NH1	104.697

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	1307	1195	91.4
¹³C chemical shifts	970	632	65.2
¹⁵N chemical shifts	235	222	94.5

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	432	414	95.8
¹³C chemical shifts	430	196	45.6
¹⁵N chemical shifts	203	200	98.5

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	875	781	89.3
¹³C chemical shifts	540	436	80.7
¹⁵N chemical shifts	32	22	68.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	97	95	97.9
¹³C chemical shifts	97	95	97.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	124	107	86.3
¹³C chemical shifts	123	60	48.8
¹⁵N chemical shifts	1	1	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	44	40	90.9
¹³C chemical shifts	35	34	97.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	30	30	100.0
¹³C chemical shifts	25	24	96.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	14	10	71.4
¹³C chemical shifts	10	10	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	6	6	100.0
¹³C chemical shifts	6	6	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	44	38	86.4
¹³C chemical shifts	35	34	97.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	30	28	93.3
¹³C chemical shifts	25	24	96.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	14	10	71.4
¹³C chemical shifts	10	10	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	6	6	100.0
¹³C chemical shifts	6	6	100.0

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_2
- Status: Warning
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 215, Sequence coverage: 99.1%
  - Entity_assembly_ID: B, Chain length: 5, Sequence coverage: 100.0%
  - Entity_assembly_ID: C, Chain length: 5, Sequence coverage: 20.0%
- Total number of restraints: 6943
- Weight of restraints: 1.0 (6943)
- Potential type of restraints: upper-bound-parabolic (6943)
- Range of distance target values: 2.4, 6.3 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
  - Chain_ID: B
  - Chain_ID: C
- Distance restraints on contact map
- Saveframe: DYANA/DIANA_distance_constraints_4
  - Status: Warning
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 215, Sequence coverage: 44.7%
  - Total number of restraints: 284
  - Weight of restraints: 1.0 (284)
  - Potential type of restraints: upper-bound-parabolic (284)
  - Range of distance target values: 1.8, 3.4 (Å)
  - Histogram of distance target values
  - Histogram of discrepancy in distance target values
  - Distance restraints per residue
    - Chain_ID: A
    - Chain_ID: B
      None
    - Chain_ID: C
      None
  - Distance restraints on contact map

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_3
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 215, Sequence coverage: 36.7%
  - Entity_assembly_ID: B, Chain length: 5, Sequence coverage: 100.0%
- Total number of restraints: 78
- Total number of restraints per polymer type: 78
- Weight of restraints: 1.0 (78)
- Potential type of restraints: square-well-parabolic (78)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: B

Keywords Protein/RNA Complex, RRM

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (1.045 seconds)

BMRB: 25043

Sample #1

Sample #2

Sample #3

Sample #4

Sample #1

Sample #2

Sample #3

Sample #4

Sample #1

Sample #2

Sample #3

Sample #4

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. Most two C-terminal RNA Recognition Motif Domain of hnRNP L bound to two equivalents ACACA RNA, entity 1, : 1 : 6 : 2 : 2 : 54 entities Detail

Experiments performed 7 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 7 contents Detail