BMRBj - BMREntryMaster

Found 1 Document (0.604 seconds)

BMRB: 25052

2MQV

A structure-based mechanism for tRNA and retroviral RNA remodeling during primer annealing

Authors

D'Souza, V.M., Yildiz, Z.

Assembly

Nucleocapsid protein p10 and RNA (68-MER)

Entity

1. Nucleocapsid protein p10 and RNA (68-MER), entity 1 (polymer), 56 monomers, 6362.125 Da Detail

ATVVSGQKQD RQGGERRRSQ LDRDQCAYCK EKGHWAKDCP KKPRGPRGPR PQTSLL

2. RNA (68-MER) (polymer, Thiol state: not present), 68 monomers, 21956.85 Da Detail

GGGCGAGGGU CUCCUCUGAG UGAUUGACUA CCCGUCAGCG GGGGUCUUUC AUUUGGGGGC UCGUGCCC

Total weight

28318.975 Da

Max. entity weight

21956.85 Da

Source organism

Murine leukemia virus , Mus musculus

Exptl. method

solution NMR

Refine. method

distance geometry

Data set

assigned_chemical_shifts

Chem. Shift Complete1

Sequence coverage: 25.8 %, Completeness: 9.3 %, Completeness (bb): 6.1 % Detail

Polymer type: polypeptide(L) polyribonucleotide

	Total	¹H
All	9.3 % (89 of 955)	9.3 % (89 of 955)
Backbone	6.1 % (32 of 521)	6.1 % (32 of 521)
Sidechain	13.1 % (57 of 434)	13.1 % (57 of 434)
Aromatic	4.8 % (8 of 166)	4.8 % (8 of 166)
Methyl	53.3 % (8 of 15)	53.3 % (8 of 15)

1. entity 1

ATVVSGQKQD RQGGERRRSQ LDRDQCAYCK EKGHWAKDCP KKPRGPRGPR PQTSLL

2. RNA (68-MER)

GGGCGAGGGU CUCCUCUGAG UGAUUGACUA CCCGUCAGCG GGGGUCUUUC AUUUGGGGGC UCGUGCCC

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 311 K, pH 7.0

#	Name	Isotope labeling	Concentration
1	U5-PBS-NC	15N,13C-Alab	0.5 mM
2	U5-PBS-NC	15N,13C-Glab	0.5 mM
3	U5-PBS-NC	15N,13C-Ulab	0.5 mM
4	U5-PBS-NC	15N,13C-Clab	0.5 mM
5	NaCl	natural abundance	10 mM
6	Tris	natural abundance	10 mM
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 311 K, pH 7.0

#	Name	Isotope labeling	Concentration
9	U5-PBS-M2-NC	natural abundance	0.5 mM
10	NaCl	natural abundance	10 mM
11	Tris	natural abundance	10 mM
12	D2O	natural abundance	100 %

Sample #3

Solvent system 100% D2O, Pressure 1 atm, Temperature 311 K, pH 7.0

#	Name	Isotope labeling	Concentration
13	UAUCG-linker	natural abundance	1 mM
14	NaCl	natural abundance	10 mM
15	Tris	natural abundance	10 mM
16	D2O	natural abundance	100 %

Chem. Shift Complete2

Sequence coverage: 48.4 %, Completeness: 13.2 %, Completeness (bb): 9.7 % Detail

Polymer type: polypeptide(L) polyribonucleotide

	Total	¹H
All	13.2 % (252 of 1910)	13.2 % (252 of 1910)
Backbone	9.7 % (101 of 1042)	9.7 % (101 of 1042)
Sidechain	17.4 % (151 of 868)	17.4 % (151 of 868)
Aromatic	28.0 % (93 of 332)	28.0 % (93 of 332)
Methyl	26.7 % (8 of 30)	26.7 % (8 of 30)

1. entity 1

ATVVSGQKQD RQGGERRRSQ LDRDQCAYCK EKGHWAKDCP KKPRGPRGPR PQTSLL

2. RNA (68-MER)

GGGCGAGGGU CUCCUCUGAG UGAUUGACUA CCCGUCAGCG GGGGUCUUUC AUUUGGGGGC UCGUGCCC

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 311 K, pH 7.0

#	Name	Isotope labeling	Concentration
1	U5-PBS-NC	15N,13C-Alab	0.5 mM
2	U5-PBS-NC	15N,13C-Glab	0.5 mM
3	U5-PBS-NC	15N,13C-Ulab	0.5 mM
4	U5-PBS-NC	15N,13C-Clab	0.5 mM
5	NaCl	natural abundance	10 mM
6	Tris	natural abundance	10 mM
7	H2O	natural abundance	90 %
8	D2O	natural abundance	10 %

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 311 K, pH 7.0

#	Name	Isotope labeling	Concentration
9	U5-PBS-M2-NC	natural abundance	0.5 mM
10	NaCl	natural abundance	10 mM
11	Tris	natural abundance	10 mM
12	D2O	natural abundance	100 %

Sample #3

Solvent system 100% D2O, Pressure 1 atm, Temperature 311 K, pH 7.0

#	Name	Isotope labeling	Concentration
13	UAUCG-linker	natural abundance	1 mM
14	NaCl	natural abundance	10 mM
15	Tris	natural abundance	10 mM
16	D2O	natural abundance	100 %

Protein Blocks Logo

Calculated from 10 models in PDB: 2MQV, Strand ID: A Detail

Release date

2015-10-15

Citation

A structure-based mechanism for tRNA and retroviral RNA remodelling during primer annealing
Miller, S.B., Yildiz, F.ZEHRA., Lo, J.A., Wang, B., D'Souza, V.M.
Nature (2014), 515, 591-595, PubMed 25209668 , DOI 10.1038/nature13709 , Abstract

Entries sharing articles BMRB: 3 entries Detail

  BMRB: 25049 released on 2015-10-15
    Title A Structure based mechanism for tRNA and retroviral RNA remodeling during primer annealing
  BMRB: 25100 released on 2015-10-15
    Title Solution NMR structure pf tRNApro:MLV-Nucleocapsid (1:2) Complex
  BMRB: 25101 released on 2015-10-15
    Title Solution NMR structure of tRNApro:MLV Nucleocapsid Protein (1:1) Complex

Related entities 1. Nucleocapsid protein p10 and RNA (68-MER), entity 1, : 1 : 9 : 1 : 20 entities Detail

Related entities 2. RNA (68-MER), : 1 : 1 entities Detail

Interaction partners 1. Nucleocapsid protein p10 and RNA (68-MER), entity 1, : 1 interactors Detail

More details for 1 interactors identified by 1 citations

Experiments performed 5 experiments Detail

NMR combined restraints 14 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_25052_2mqv.nef
Input source #2: Coordindates	2mqv.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	True (see coodinates for details)
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Ptnr_site_1	Ptnr_site_2	Redox_state_prediction_1	Redox_state_prediction_2	Distance (Å)
1:39:CYS:SG	3:1:ZN:ZN	unknown	unknown	n/a
1:34:HIS:NE2	3:1:ZN:ZN	unknown	unknown	n/a
1:29:CYS:SG	3:1:ZN:ZN	unknown	unknown	n/a
1:26:CYS:SG	3:1:ZN:ZN	unknown	unknown	n/a

Non-standard residues

Chain_ID	Seq_ID	Comp_ID	Chem_comp_name	Experimental evidences
C	1	ZN	ZINC ION	None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50------
ATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPRPQTSLL
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
ATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPRPQTSLL

Entity_assembly_ID (NMR): B vs Auth_asym_ID (model): B

-----100-------110-------120-------130-------140-------150-------160
GGGCGAGGGUCUCCUCUGAGUGAUUGACUACCCGUCAGCGGGGGUCUUUCAUUUGGGGGCUCGUGCCC
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GGGCGAGGGUCUCCUCUGAGUGAUUGACUACCCGUCAGCGGGGGUCUUUCAUUUGGGGGCUCGUGCCC
--------10--------20--------30--------40--------50--------60--------

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	56	0	0	100.0
B	B	68	0	0	100.0

Content subtype: combined_25052_2mqv.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Covalent bonds	assembly	OK	4		No information
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	89		57.1 (chain: A, length: 56)
2	Assigned chemical shifts	assigned_chem_shift_list_1_dup	Warning	149		83.8 (chain: B, length: 68)
1	Distance restraints	DYANA/DIANA_distance_constraints_12	OK	35 (1)	undefined	50.0 (chain: B, length: 68)
2	Distance restraints	DYANA/DIANA_distance_constraints_5	Warning	181 (1)	noe	58.9 (chain: A, length: 56), 5.9 (chain: B, length: 68)
3	Distance restraints	DYANA/DIANA_distance_constraints_10	Warning	299 (1)	noe	57.4 (chain: B, length: 68)
4	Distance restraints	DYANA/DIANA_distance_constraints_6	Warning	22 (1)	undefined	19.6 (chain: A, length: 56), 5.9 (chain: B, length: 68)
5	Distance restraints	DYANA/DIANA_distance_constraints_11	OK	216 (1)	noe	42.6 (chain: B, length: 68)
6	Distance restraints	DYANA/DIANA_distance_constraints_3	Warning	6 (1)	undefined	7.1 (chain: A, length: 56)
7	Distance restraints	DYANA/DIANA_distance_constraints_7	Warning	65 (1)	noe	23.2 (chain: A, length: 56), 5.9 (chain: B, length: 68)
8	Distance restraints	DYANA/DIANA_distance_constraints_8	OK	136 (1)	undefined	100.0 (chain: B, length: 68)
9	Distance restraints	DYANA/DIANA_distance_constraints_4	OK	27 (1)	hbond	32.1 (chain: A, length: 56)
10	Distance restraints	DYANA/DIANA_distance_constraints_9	Warning	132 (1)	hbond	73.5 (chain: B, length: 68)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_2	OK	289 (289)	.	86.8 (chain: B, length: 68)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 56, Sequence coverage: 57.1%
- Total number of assignments
  - ¹H chemical shifts: 89
- Completeness of assignments
  - Entity_assemble_ID: A
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A
Saveframe: assigned_chem_shift_list_1_dup
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: B, Chain length: 68, Sequence coverage: 83.8%
- Total number of assignments
  - ¹H chemical shifts: 149
- Completeness of assignments
  - Entity_assemble_ID: B
- Histogram of normalized assigned chemical shifts

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
34	HIS	HD1	7.09273444444

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	357	86	24.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	113	29	25.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	244	57	23.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	15	8	53.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	12	8	66.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	598	149	24.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	408	64	15.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	190	85	44.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	39	32	82.1

Covalent bonds

Saveframe: assembly
- Status: OK

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_12
- Status: OK
- Experiment type: undefined
- Sequence coverage of experimental data
  - Entity_assembly_ID: B, Chain length: 68, Sequence coverage: 50.0%
- Total number of restraints: 35
- Weight of restraints: 1.0 (35)
- Potential type of restraints: upper-bound-parabolic (35)
- Range of distance target values: 2.3, 17.5 (Å)
- Histogram of distance target values
- Distance restraints per residue
  - Chain_ID: A
  - Chain_ID: B
  - Chain_ID: C
    None
- Distance restraints on contact map
- Saveframe: DYANA/DIANA_distance_constraints_5
  - Status: Warning
  - Experiment type: noe
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 56, Sequence coverage: 58.9%
    - Entity_assembly_ID: B, Chain length: 68, Sequence coverage: 5.9%
  - Total number of restraints: 181
  - Weight of restraints: 1.0 (181)
  - Potential type of restraints: upper-bound-parabolic (181)
  - Range of distance target values: 2.7, 6.3 (Å)
  - Histogram of distance target values
  - Distance restraints per residue
    - Chain_ID: A
    - Chain_ID: B
    - Chain_ID: C
      None
  - Distance restraints on contact map
  - Saveframe: DYANA/DIANA_distance_constraints_10
    - Status: Warning
    - Experiment type: noe
    - Sequence coverage of experimental data
      - Entity_assembly_ID: B, Chain length: 68, Sequence coverage: 57.4%
    - Total number of restraints: 299
    - Weight of restraints: 1.0 (299)
    - Potential type of restraints: upper-bound-parabolic (299)
    - Range of distance target values: 1.89, 6.5 (Å)
    - Histogram of distance target values
    - Distance restraints per residue
      - Chain_ID: A
        None
      - Chain_ID: B
      - Chain_ID: C
        None
    - Distance restraints on contact map
    - Saveframe: DYANA/DIANA_distance_constraints_6
      - Status: Warning
      - Experiment type: undefined
      - Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 56, Sequence coverage: 19.6%
        Entity_assembly_ID: B, Chain length: 68, Sequence coverage: 5.9%
      - Total number of restraints: 22
        Total hydrogen bond restraints: 22
      - Weight of restraints: 1.0 (22)
        Total hydrogen bond restraints: 1.0 (22)
      - Potential type of restraints: upper-bound-parabolic (22)
        Total hydrogen bond restraints: upper-bound-parabolic (22)
      - Range of distance target values: 2.0, 3.8 (Å)
      - Histogram of distance target values
      - Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        Chain_ID: C
        None
      - Distance restraints on contact map
      - Saveframe: DYANA/DIANA_distance_constraints_11
        Status: OK
        Experiment type: noe
        Sequence coverage of experimental data
        Entity_assembly_ID: B, Chain length: 68, Sequence coverage: 42.6%
        Total number of restraints: 216
        Intra-residue restraints, i = j : 141
        Sequential restraints, | i - j | = 1 : 75
        Backbone-side chain: 50
        Side chain-side chain: 25
        Weight of restraints: 1.0 (216)
        Intra-residue restraints, i = j : 1.0 (141)
        Sequential restraints, | i - j | = 1 : 1.0 (75)
        Backbone-side chain: 1.0 (50)
        Side chain-side chain: 1.0 (25)
        Potential type of restraints: upper-bound-parabolic (216)
        Intra-residue restraints, i = j : upper-bound-parabolic (141)
        Sequential restraints, | i - j | = 1 : upper-bound-parabolic (75)
        Backbone-side chain: upper-bound-parabolic (50)
        Side chain-side chain: upper-bound-parabolic (25)
        Range of distance target values: 2.7, 5.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        None
        Chain_ID: B
        Chain_ID: C
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_3
        Status: Warning
        Experiment type: undefined
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 56, Sequence coverage: 7.1%
        Total number of restraints: 6
        Long range restraints, | i - j | >= 5 : 3
        Total disulfide bond restraints: 3
        S...S (too far!): 1
        Long range: 2
        S...S (too far!): 2
        Weight of restraints: 1.0 (6)
        Long range restraints, | i - j | >= 5 : 1.0 (3)
        Total disulfide bond restraints: 1.0 (3)
        S...S (too far!): 1.0 (1)
        Long range: 1.0 (2)
        S...S (too far!): 1.0 (2)
        Potential type of restraints: upper-bound-parabolic (6)
        Long range restraints, | i - j | >= 5 : upper-bound-parabolic (3)
        Total disulfide bond restraints: upper-bound-parabolic (3)
        S...S (too far!): upper-bound-parabolic (1)
        Long range: upper-bound-parabolic (2)
        S...S (too far!): upper-bound-parabolic (2)
        Range of distance target values: 3.85, 3.85 (Å)
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_7
        Status: Warning
        Experiment type: noe
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 56, Sequence coverage: 23.2%
        Entity_assembly_ID: B, Chain length: 68, Sequence coverage: 5.9%
        Total number of restraints: 65
        Inter-chain restraints: 11
        Symmetric restraints: 54
        Weight of restraints: 1.0 (65)
        Inter-chain restraints: 1.0 (11)
        Symmetric restraints: 1.0 (54)
        Potential type of restraints: upper-bound-parabolic (65)
        Inter-chain restraints: upper-bound-parabolic (11)
        Symmetric restraints: upper-bound-parabolic (54)
        Range of distance target values: 2.7, 6.5 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        Chain_ID: C
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_8
        Status: OK
        Experiment type: undefined
        Sequence coverage of experimental data
        Entity_assembly_ID: B, Chain length: 68, Sequence coverage: 100.0%
        -----100-------110-------120-------130-------140-------150-------160 GGGCGAGGGUCUCCUCUGAGUGAUUGACUACCCGUCAGCGGGGGUCUUUCAUUUGGGGGCUCGUGCCC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GGGCGAGGGUCUCCUCUGAGUGAUUGACUACCCGUCAGCGGGGGUCUUUCAUUUGGGGGCUCGUGCCC
        Total number of restraints: 136
        Intra-residue restraints, i = j : 136
        Weight of restraints: 1.0 (136)
        Intra-residue restraints, i = j : 1.0 (136)
        Potential type of restraints: upper-bound-parabolic (136)
        Intra-residue restraints, i = j : upper-bound-parabolic (136)
        Range of distance target values: 1.46, 2.42 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        None
        Chain_ID: B
        Chain_ID: C
        None
        Distance restraints on contact map
        Chain_ID_1: B - Chain_ID_2: B
        Saveframe: DYANA/DIANA_distance_constraints_4
        Status: OK
        Experiment type: hbond
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 56, Sequence coverage: 32.1%
        Total number of restraints: 27
        Medium range restraints, 1 < | i - j | < 5 : 8
        Total hydrogen bond restraints: 19
        O...h-N: 7
        O...H-x: 7
        Long range: 5
        O...h-N: 3
        O...H-x: 2
        Weight of restraints: 1.0 (27)
        Medium range restraints, 1 < | i - j | < 5 : 1.0 (8)
        Total hydrogen bond restraints: 1.0 (19)
        O...h-N: 1.0 (7)
        O...H-x: 1.0 (7)
        Long range: 1.0 (5)
        O...h-N: 1.0 (3)
        O...H-x: 1.0 (2)
        Potential type of restraints: upper-bound-parabolic (27)
        Medium range restraints, 1 < | i - j | < 5 : upper-bound-parabolic (8)
        Total hydrogen bond restraints: upper-bound-parabolic (19)
        O...h-N: upper-bound-parabolic (7)
        O...H-x: upper-bound-parabolic (7)
        Long range: upper-bound-parabolic (5)
        O...h-N: upper-bound-parabolic (3)
        O...H-x: upper-bound-parabolic (2)
        Range of distance target values: 2.0, 3.65 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_9
        Status: Warning
        Experiment type: hbond
        Sequence coverage of experimental data
        Entity_assembly_ID: B, Chain length: 68, Sequence coverage: 73.5%
        -----100-------110-------120-------130-------140-------150-------160 GGGCGAGGGUCUCCUCUGAGUGAUUGACUACCCGUCAGCGGGGGUCUUUCAUUUGGGGGCUCGUGCCC |||| | |||||| |||||||||| |||| |||||||||||||| |||||| | |||| GGGC..G.GUCUCC.....GUGAUUGACU.CCCG....CGGGGGUCUUUCAU..GGGGGC.C..GCCC
        Total number of restraints: 132
        Total hydrogen bond restraints: 132
        N...H-x (too close!): 1
        N...h_N: 1
        O...H-x (too close!): 2
        O...h-N: 2
        Long range: 126
        N...H-x (too close!): 18
        N...h_N: 18
        O...H-x (too close!): 45
        O...h-N: 45
        Weight of restraints: 1.0 (132)
        Total hydrogen bond restraints: 1.0 (132)
        N...H-x (too close!): 1.0 (1)
        N...h_N: 1.0 (1)
        O...H-x (too close!): 1.0 (2)
        O...h-N: 1.0 (2)
        Long range: 1.0 (126)
        N...H-x (too close!): 1.0 (18)
        N...h_N: 1.0 (18)
        O...H-x (too close!): 1.0 (45)
        O...h-N: 1.0 (45)
        Potential type of restraints: upper-bound-parabolic (132)
        Total hydrogen bond restraints: upper-bound-parabolic (132)
        N...H-x (too close!): upper-bound-parabolic (1)
        N...h_N: upper-bound-parabolic (1)
        O...H-x (too close!): upper-bound-parabolic (2)
        O...h-N: upper-bound-parabolic (2)
        Long range: upper-bound-parabolic (126)
        N...H-x (too close!): upper-bound-parabolic (18)
        N...h_N: upper-bound-parabolic (18)
        O...H-x (too close!): upper-bound-parabolic (45)
        O...h-N: upper-bound-parabolic (45)
        Range of distance target values: 1.89, 3.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        None
        Chain_ID: B
        Chain_ID: C
        None
        Distance restraints on contact map
        Chain_ID_1: B - Chain_ID_2: B

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_2
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: B, Chain length: 68, Sequence coverage: 86.8%
- Total number of restraints: 289
- Total number of restraints per polymer type: 289
- Weight of restraints: 1.0 (289)
- Potential type of restraints: square-well-parabolic (289)
- Dihedral angle restraints per residue
  - Chain_ID: B

Keywords PROTEIN-RNA

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.604 seconds)

BMRB: 25052

Sample #1

Sample #2

Sample #3

Sample #1

Sample #2

Sample #3

Entries sharing articles BMRB: 3 entries Detail

Related entities 1. Nucleocapsid protein p10 and RNA (68-MER), entity 1, : 1 : 9 : 1 : 20 entities Detail

Related entities 2. RNA (68-MER), : 1 : 1 entities Detail

Interaction partners 1. Nucleocapsid protein p10 and RNA (68-MER), entity 1, : 1 interactors Detail

Experiments performed 5 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 14 contents Detail