Solution NMR Structure of De novo designed Protein, Northeast Structural Genomics Consortium (NESG) Target OR457
MGTVVIVVSN DERILEELLE VVLKSDPNVK TVRTDDKEKV KEEIEKARKQ GRPIVIFIRG AYEEVVRDIV EYAQKEGLRV LVIKVAQDQE LLERFYEQLK KDGVDVRVTD NEDEAKKRLK ELLEKVGSLE HHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.4 % (1455 of 1646) | 87.5 % (757 of 865) | 89.8 % (574 of 639) | 87.3 % (124 of 142) |
Backbone | 88.7 % (720 of 812) | 87.3 % (241 of 276) | 90.3 % (363 of 402) | 86.6 % (116 of 134) |
Sidechain | 88.7 % (855 of 964) | 87.6 % (516 of 589) | 90.2 % (331 of 367) | 100.0 % (8 of 8) |
Aromatic | 64.7 % (44 of 68) | 64.7 % (22 of 34) | 64.7 % (22 of 34) | |
Methyl | 94.5 % (172 of 182) | 93.4 % (85 of 91) | 95.6 % (87 of 91) |
1. OR457
MGTVVIVVSN DERILEELLE VVLKSDPNVK TVRTDDKEKV KEEIEKARKQ GRPIVIFIRG AYEEVVRDIV EYAQKEGLRV LVIKVAQDQE LLERFYEQLK KDGVDVRVTD NEDEAKKRLK ELLEKVGSLE HHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.85 mM OR457.004, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR457.004 | [U-13C,15N] | 0.85 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.8 mM OR457.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR457.003 | [5% 13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz UB High-field NMR facility
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.8 mM OR457.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR457.003 | [5% 13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz UB High-field NMR facility
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.8 mM OR457.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR457.003 | [5% 13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz UB High-field NMR facility
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.8 mM OR457.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR457.003 | [5% 13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz UB High-field NMR facility
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.8 mM OR457.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR457.003 | [5% 13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz UB High-field NMR facility
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.8 mM OR457.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR457.003 | [5% 13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz UB High-field NMR facility
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.8 mM OR457.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR457.003 | [5% 13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz UB High-field NMR facility
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.8 mM OR457.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR457.003 | [5% 13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz UB High-field NMR facility
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.8 mM OR457.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR457.003 | [5% 13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz UB High-field NMR facility
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.8 mM OR457.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR457.003 | [5% 13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz UB High-field NMR facility
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.8 mM OR457.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR457.003 | [5% 13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz UB High-field NMR facility
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.8 mM OR457.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR457.003 | [5% 13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25061_2mr5.nef |
Input source #2: Coordindates | 2mr5.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGTVVIVVSNDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGAYEEVVRDIVEYAQKEGLRVLVIKVAQDQELLERFYEQLK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGTVVIVVSNDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGAYEEVVRDIVEYAQKEGLRVLVIKVAQDQELLERFYEQLK -------110-------120-------130------ KDGVDVRVTDNEDEAKKRLKELLEKVGSLEHHHHHH |||||||||||||||||||||||||||||||||||| KDGVDVRVTDNEDEAKKRLKELLEKVGSLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 136 | 0 | 0 | 100.0 |
Content subtype: combined_25061_2mr5.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGTVVIVVSNDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGAYEEVVRDIVEYAQKEGLRVLVIKVAQDQELLERFYEQLK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| .GTVVIVVSNDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGAYEEVVRDIVEYAQKEGLRVLVIKVAQDQ..LERFYEQLK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------ KDGVDVRVTDNEDEAKKRLKELLEKVGSLEHHHHHH |||||||||||||||||||||||||||||| KDGVDVRVTDNEDEAKKRLKELLEKVGSLE -------110-------120-------130
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 865 | 780 | 90.2 |
13C chemical shifts | 639 | 583 | 91.2 |
15N chemical shifts | 152 | 120 | 78.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 276 | 244 | 88.4 |
13C chemical shifts | 272 | 246 | 90.4 |
15N chemical shifts | 134 | 112 | 83.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 589 | 536 | 91.0 |
13C chemical shifts | 367 | 337 | 91.8 |
15N chemical shifts | 18 | 8 | 44.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 92 | 89 | 96.7 |
13C chemical shifts | 92 | 89 | 96.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 22 | 64.7 |
13C chemical shifts | 34 | 22 | 64.7 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGTVVIVVSNDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGAYEEVVRDIVEYAQKEGLRVLVIKVAQDQELLERFYEQLK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| .GTVVIVVSNDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGAYEEVVRDIVEYAQKEGLRVLVIKVAQDQ..LERFYEQLK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------ KDGVDVRVTDNEDEAKKRLKELLEKVGSLEHHHHHH |||||||||||||||||||||||||||||| KDGVDVRVTDNEDEAKKRLKELLEKVGSLE -------110-------120-------130
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGTVVIVVSNDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGAYEEVVRDIVEYAQKEGLRVLVIKVAQDQELLERFYEQLK ||||||| |||||||||||||| |||| ||||||||||||| ||||| |||||||||||||||| |||||||| |||||||||||| ..TVVIVVS..ERILEELLEVVLKS.....TVRT..KEKVKEEIEKARK....IVIFI.GAYEEVVRDIVEYAQK...RVLVIKVA..QELLERFYEQLK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------ KDGVDVRVTDNEDEAKKRLKELLEKVGSLEHHHHHH | ||||| |||||||||||||| K...DVRVT..EDEAKKRLKELLEK -------110-------120-----