Solution NMR Structure of De novo designed protein, Northeast Structural Genomics Consortium (NESG) Target OR462
MGVVILVLTG DERIAEELRK EVQKHDPNVK TVPTKDKEKV KEEIEKARKQ GRPIVVFVRG GDDERAKDIA EYAQKEGLRV IVIIVSQDEE ALRKGYEDKK KKGYDVYTSR NEDEAKKKLK EALEKSGSLE HHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.7 % (1560 of 1630) | 95.3 % (824 of 865) | 96.5 % (604 of 626) | 95.0 % (132 of 139) |
Backbone | 96.3 % (780 of 810) | 96.0 % (267 of 278) | 97.0 % (387 of 399) | 94.7 % (126 of 133) |
Sidechain | 95.4 % (903 of 947) | 94.9 % (557 of 587) | 96.0 % (340 of 354) | 100.0 % (6 of 6) |
Aromatic | 77.1 % (54 of 70) | 77.1 % (27 of 35) | 77.1 % (27 of 35) | |
Methyl | 100.0 % (144 of 144) | 100.0 % (72 of 72) | 100.0 % (72 of 72) |
1. OR462
MGVVILVLTG DERIAEELRK EVQKHDPNVK TVPTKDKEKV KEEIEKARKQ GRPIVVFVRG GDDERAKDIA EYAQKEGLRV IVIIVSQDEE ALRKGYEDKK KKGYDVYTSR NEDEAKKKLK EALEKSGSLE HHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR462 | [U-13C; U-15N] | 1.2 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR462 | [U-13C; U-15N] | 1.2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.2 mM OR462, 90% H2O/10% D2O,pH7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR462 | [U-13C; U-15N] | 1.2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25062_2mr6.nef |
Input source #2: Coordindates | 2mr6.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQGRPIVVFVRGGDDERAKDIAEYAQKEGLRVIVIIVSQDEEALRKGYEDKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQGRPIVVFVRGGDDERAKDIAEYAQKEGLRVIVIIVSQDEEALRKGYEDKK -------110-------120-------130------ KKGYDVYTSRNEDEAKKKLKEALEKSGSLEHHHHHH |||||||||||||||||||||||||||||||||||| KKGYDVYTSRNEDEAKKKLKEALEKSGSLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 136 | 0 | 0 | 100.0 |
Content subtype: combined_25062_2mr6.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQGRPIVVFVRGGDDERAKDIAEYAQKEGLRVIVIIVSQDEEALRKGYEDKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQGRPIVVFVRGGDDERAKDIAEYAQKEGLRVIVIIVSQDEEALRKGYEDKK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------ KKGYDVYTSRNEDEAKKKLKEALEKSGSLEHHHHHH |||||||||||||||||||||||||||||||| KKGYDVYTSRNEDEAKKKLKEALEKSGSLEHH -------110-------120-------130--
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
9 | THR | HG1 | 5.129 |
25 | HIS | ND1 | 239.34 |
25 | HIS | NE2 | 173.536 |
109 | SER | HG | 3.164 |
131 | HIS | ND1 | 214.511 |
131 | HIS | NE2 | 182.655 |
132 | HIS | ND1 | 204.993 |
132 | HIS | NE2 | 184.724 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 865 | 821 | 94.9 |
13C chemical shifts | 626 | 602 | 96.2 |
15N chemical shifts | 148 | 130 | 87.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 278 | 265 | 95.3 |
13C chemical shifts | 272 | 263 | 96.7 |
15N chemical shifts | 133 | 124 | 93.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 587 | 556 | 94.7 |
13C chemical shifts | 354 | 339 | 95.8 |
15N chemical shifts | 15 | 6 | 40.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 73 | 100.0 |
13C chemical shifts | 73 | 73 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 27 | 77.1 |
13C chemical shifts | 35 | 27 | 77.1 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQGRPIVVFVRGGDDERAKDIAEYAQKEGLRVIVIIVSQDEEALRKGYEDKK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQGRPIVVFVRGGDDERAKDIAEYAQKEGLRVIVIIVSQDEEALRKGYEDKK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------ KKGYDVYTSRNEDEAKKKLKEALEKSGSLEHHHHHH ||||||||||||||||||||||||||||||| KKGYDVYTSRNEDEAKKKLKEALEKSGSLEH -------110-------120-------130-
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQGRPIVVFVRGGDDERAKDIAEYAQKEGLRVIVIIVSQDEEALRKGYEDKK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQGRPIVVFVRGGDDERAKDIAEYAQKEGLRVIVIIVSQDEEALRKGYEDKK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------ KKGYDVYTSRNEDEAKKKLKEALEKSGSLEHHHHHH ||||||||||||||||||||||||||||||| KKGYDVYTSRNEDEAKKKLKEALEKSGSLEH -------110-------120-------130-
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQGRPIVVFVRGGDDERAKDIAEYAQKEGLRVIVIIVSQDEEALRKGYEDKK ||||||||||||||||||||||||| ||||||| |||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||| .GVVILVLTGDERIAEELRKEVQKHD.NVKTVPT.DKEKVKEEIEKARKQGRPIVVFVR..DDERAKDIAEYAQKEGLRVIVIIVSQDEEALRKGYEDKK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------ KKGYDVYTSRNEDEAKKKLKEALEKSGSLEHHHHHH |||||||||||||||||||||||||| | KKGYDVYTSRNEDEAKKKLKEALEKS..L -------110-------120---------