Fyn SH2 bound
SSGLVPRGSH MEWYFGKLGR KDAERQLLSF GNPRGTFLIR ESETTKGAYS LSIRDWDDMK GDHVKHYKIR KLDNGGYYIT TRAQFETLQQ LVQHYSERAA GLCCRLVVPC HK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.2 % (1279 of 1330) | 95.4 % (665 of 697) | 96.7 % (498 of 515) | 98.3 % (116 of 118) |
Backbone | 98.3 % (655 of 666) | 98.3 % (228 of 232) | 98.5 % (320 of 325) | 98.2 % (107 of 109) |
Sidechain | 94.8 % (725 of 765) | 94.0 % (437 of 465) | 95.9 % (279 of 291) | 100.0 % (9 of 9) |
Aromatic | 87.9 % (116 of 132) | 87.9 % (58 of 66) | 87.5 % (56 of 64) | 100.0 % (2 of 2) |
Methyl | 100.0 % (102 of 102) | 100.0 % (51 of 51) | 100.0 % (51 of 51) |
1. FynSH2 bound
SSGLVPRGSH MEWYFGKLGR KDAERQLLSF GNPRGTFLIR ESETTKGAYS LSIRDWDDMK GDHVKHYKIR KLDNGGYYIT TRAQFETLQQ LVQHYSERAA GLCCRLVVPC HKSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.50
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2 bound | [U-99% 13C; U-99% 15N] | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.50
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2 bound | [U-99% 13C; U-99% 15N] | 1 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.50
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2 bound | [U-99% 13C; U-99% 15N] | 1 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.50
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2 bound | [U-99% 13C; U-99% 15N] | 1 mM |
Varian Varian NMR Systems - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.50
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2 bound | [U-99% 13C; U-99% 15N] | 1 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.50
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2 bound | [U-99% 13C; U-99% 15N] | 1 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.50
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2 bound | [U-99% 13C; U-99% 15N] | 1 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.50
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2 bound | [U-99% 13C; U-99% 15N] | 1 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.50
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2 bound | [U-99% 13C; U-99% 15N] | 1 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.50
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2 bound | [U-99% 13C; U-99% 15N] | 1 mM |
Varian Varian NMR Systems - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.50
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2 bound | [U-99% 13C; U-99% 15N] | 1 mM |
Varian Varian NMR Systems - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.50
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2 bound | [U-99% 13C; U-99% 15N] | 1 mM |
Varian Varian NMR Systems - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.50
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FynSH2 bound | [U-99% 13C; U-99% 15N] | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25081_2mrj.nef |
Input source #2: Coordindates | 2mrj.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---140-----150-------160-------170-------180-------190-------200-------210-------220-------230------ SSGLVPRGSHMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SSGLVPRGSHMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAA --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -240-------- GLCCRLVVPCHK |||||||||||| GLCCRLVVPCHK -------110--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 112 | 0 | 0 | 100.0 |
Content subtype: combined_25081_2mrj.nef
Assigned chemical shifts
---140-----150-------160-------170-------180-------190-------200-------210-------220-------230------ SSGLVPRGSHMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SSGLVPRGSHMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAA -240-------- GLCCRLVVPCHK |||||||||||| GLCCRLVVPCHK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 697 | 668 | 95.8 |
13C chemical shifts | 515 | 497 | 96.5 |
15N chemical shifts | 128 | 115 | 89.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 232 | 229 | 98.7 |
13C chemical shifts | 224 | 218 | 97.3 |
15N chemical shifts | 109 | 106 | 97.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 465 | 439 | 94.4 |
13C chemical shifts | 291 | 279 | 95.9 |
15N chemical shifts | 19 | 9 | 47.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 53 | 100.0 |
13C chemical shifts | 53 | 53 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 58 | 87.9 |
13C chemical shifts | 64 | 56 | 87.5 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
---140-----150-------160-------170-------180-------190-------200-------210-------220-------230------ SSGLVPRGSHMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ............WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAA -240-------- GLCCRLVVPCHK |||||||||||| GLCCRLVVPCHK
Dihedral angle restraints
---140-----150-------160-------170-------180-------190-------200-------210-------220-------230------ SSGLVPRGSHMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAA ||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||| ............WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKG.HVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAA -240-------- GLCCRLVVPCHK |||||||||||| GLCCRLVVPCHK