Solution structure of the rhodanese domain of YgaP from E. coli
MHHHHHHMAL TTISPHDAQE LIARGAKLID IRDADEYLRE HIPEADLAPL SVLEQSGLPA KLRHEQIIFH CQAGKRTSNN ADKLAAIAAP AEIFLLEDGI DGWKRAGLPV AVNK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.4 % (1097 of 1300) | 85.9 % (578 of 673) | 81.4 % (416 of 511) | 88.8 % (103 of 116) |
Backbone | 91.4 % (614 of 672) | 92.1 % (210 of 228) | 90.5 % (304 of 336) | 92.6 % (100 of 108) |
Sidechain | 78.1 % (575 of 736) | 82.0 % (365 of 445) | 73.5 % (208 of 283) | 25.0 % (2 of 8) |
Aromatic | 5.0 % (4 of 80) | 7.5 % (3 of 40) | 0.0 % (0 of 39) | 100.0 % (1 of 1) |
Methyl | 89.6 % (129 of 144) | 97.2 % (70 of 72) | 81.9 % (59 of 72) |
1. YgaP
MHHHHHHMAL TTISPHDAQE LIARGAKLID IRDADEYLRE HIPEADLAPL SVLEQSGLPA KLRHEQIIFH CQAGKRTSNN ADKLAAIAAP AEIFLLEDGI DGWKRAGLPV AVNKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaP | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | YgaP | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | TRIS | natural abundance | 20 mM | |
9 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaP | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaP | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaP | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaP | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaP | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaP | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaP | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaP | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | TRIS | natural abundance | 20 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | YgaP | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | TRIS | natural abundance | 20 mM | |
9 | D2O | natural abundance | 100 % |
Varian INOVA - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | YgaP | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | TRIS | natural abundance | 20 mM | |
9 | D2O | natural abundance | 100 % |
Varian INOVA - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | YgaP | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | TRIS | natural abundance | 20 mM | |
9 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25085_2mrm.nef |
Input source #2: Coordindates | 2mrm.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- MHHHHHHMALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MHHHHHHMALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ----100------- DGWKRAGLPVAVNK |||||||||||||| DGWKRAGLPVAVNK -------110----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 114 | 0 | 0 | 100.0 |
Content subtype: combined_25085_2mrm.nef
Assigned chemical shifts
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- MHHHHHHMALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......MALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGI ----100------- DGWKRAGLPVAVNK |||||||||||||| DGWKRAGLPVAVNK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 673 | 580 | 86.2 |
13C chemical shifts | 511 | 415 | 81.2 |
15N chemical shifts | 122 | 102 | 83.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 228 | 214 | 93.9 |
13C chemical shifts | 228 | 207 | 90.8 |
15N chemical shifts | 108 | 101 | 93.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 445 | 366 | 82.2 |
13C chemical shifts | 283 | 208 | 73.5 |
15N chemical shifts | 14 | 1 | 7.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 74 | 72 | 97.3 |
13C chemical shifts | 74 | 60 | 81.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 3 | 7.5 |
13C chemical shifts | 39 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- MHHHHHHMALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......MALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGI ----100------- DGWKRAGLPVAVNK |||||||||||||| DGWKRAGLPVAVNK
Dihedral angle restraints
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- MHHHHHHMALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGI |||||||||||||| |||||| |||||||| |||||||||||| ||||| |||||||| |||||||||||||| ||||| || ..........TTISPHDAQELIAR.AKLIDI.DADEYLRE....ADLAPLSVLEQS..PAKLR.EQIIFHCQ..KRTSNNADKLAAIA...EIFLL..GI ----100------- DGWKRAGLPVAVNK |||||| |||||| DGWKRA..PVAVNK