NMR solution structure of copper binding protein in the apo form
GAMGQKAQQK NGYQEIRVEV MGGYTPELIV LKKSVPARIV FDRKDPSPCL DQIVFPDFGV HANLPMGEEY VVEITPEQAG EFSFACGMNM MHGKMIVE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 77.7 % (887 of 1142) | 85.3 % (510 of 598) | 65.8 % (292 of 444) | 85.0 % (85 of 100) |
Backbone | 78.2 % (449 of 574) | 92.0 % (183 of 199) | 63.7 % (181 of 284) | 93.4 % (85 of 91) |
Sidechain | 79.1 % (519 of 656) | 82.0 % (327 of 399) | 77.4 % (192 of 248) | 0.0 % (0 of 9) |
Aromatic | 50.0 % (41 of 82) | 90.2 % (37 of 41) | 9.8 % (4 of 41) | |
Methyl | 97.9 % (94 of 96) | 97.9 % (47 of 48) | 97.9 % (47 of 48) |
1. entity
GAMGQKAQQK NGYQEIRVEV MGGYTPELIV LKKSVPARIV FDRKDPSPCL DQIVFPDFGV HANLPMGEEY VVEITPEQAG EFSFACGMNM MHGKMIVESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 ~ 0.6 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 5 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | DSS | natural abundance | 10 uM | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | D2O | [U-99% 2H] | 10 % | |
9 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 ~ 0.6 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 5 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | DSS | natural abundance | 10 uM | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | D2O | [U-99% 2H] | 10 % | |
9 | H2O | natural abundance | 90 % |
Agilent VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 ~ 0.6 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 5 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | DSS | natural abundance | 10 uM | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | D2O | [U-99% 2H] | 10 % | |
9 | H2O | natural abundance | 90 % |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 ~ 0.6 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 5 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | DSS | natural abundance | 10 uM | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | D2O | [U-99% 2H] | 10 % | |
9 | H2O | natural abundance | 90 % |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 ~ 0.6 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 5 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | DSS | natural abundance | 10 uM | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | D2O | [U-99% 2H] | 10 % | |
9 | H2O | natural abundance | 90 % |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 ~ 0.6 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 5 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | DSS | natural abundance | 10 uM | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | D2O | [U-99% 2H] | 10 % | |
9 | H2O | natural abundance | 90 % |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 ~ 0.6 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 5 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | DSS | natural abundance | 10 uM | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | D2O | [U-99% 2H] | 10 % | |
9 | H2O | natural abundance | 90 % |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 ~ 0.6 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 5 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | DSS | natural abundance | 10 uM | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | D2O | [U-99% 2H] | 10 % | |
9 | H2O | natural abundance | 90 % |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 ~ 0.6 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 5 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | DSS | natural abundance | 10 uM | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | D2O | [U-99% 2H] | 10 % | |
9 | H2O | natural abundance | 90 % |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 ~ 0.6 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 5 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | DSS | natural abundance | 10 uM | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | D2O | [U-99% 2H] | 10 % | |
9 | H2O | natural abundance | 90 % |
Agilent VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 ~ 0.6 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 5 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | DSS | natural abundance | 10 uM | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | D2O | [U-99% 2H] | 10 % | |
9 | H2O | natural abundance | 90 % |
Agilent VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 ~ 0.6 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 5 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | DSS | natural abundance | 10 uM | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | D2O | [U-99% 2H] | 10 % | |
9 | H2O | natural abundance | 90 % |
Agilent VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 ~ 0.6 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | EDTA | natural abundance | 5 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | DSS | natural abundance | 10 uM | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | D2O | [U-99% 2H] | 10 % | |
9 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25098_2mry.nef |
Input source #2: Coordindates | 2mry.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---30--------40--------50--------60--------70--------80--------90-------100-------110-------120--- GAMGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACGMNMMHGKMIVE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACGMNMMHGKMIVE --------10--------20--------30--------40--------50--------60--------70--------80--------90--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 98 | 0 | 0 | 100.0 |
Content subtype: combined_25098_2mry.nef
Assigned chemical shifts
---30--------40--------50--------60--------70--------80--------90-------100-------110-------120--- GAMGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACGMNMMHGKMIVE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| ..MGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACG...MHGKMIVE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 598 | 495 | 82.8 |
15N chemical shifts | 103 | 84 | 81.6 |
13C chemical shifts | 444 | 269 | 60.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 199 | 181 | 91.0 |
15N chemical shifts | 91 | 84 | 92.3 |
13C chemical shifts | 196 | 87 | 44.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 399 | 314 | 78.7 |
15N chemical shifts | 12 | 0 | 0.0 |
13C chemical shifts | 248 | 182 | 73.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 52 | 94.5 |
13C chemical shifts | 55 | 51 | 92.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 37 | 90.2 |
13C chemical shifts | 41 | 0 | 0.0 |
Distance restraints
---30--------40--------50--------60--------70--------80--------90-------100-------110-------120--- GAMGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACGMNMMHGKMIVE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| ...GQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACG...MHGKMIVE
Dihedral angle restraints
---30--------40--------50--------60--------70--------80--------90-------100-------110-------120--- GAMGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACGMNMMHGKMIVE |||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| ...GQKAQQKNGYQEIRVEVMGGYT.ELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACG...MHGKMIVE