Solution NMR structure of MAVS CARD
GSMPFAEDKT YKYICRNFSN FCNVDVVEIL PYLPCLTARD QDRLRATCTL SGNRDTLWHL FNTLQRRPGW VEYFIAALRG CELVDLADEV ASVYQSYQPR TS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.2 % (1141 of 1199) | 97.1 % (602 of 620) | 91.7 % (432 of 471) | 99.1 % (107 of 108) |
Backbone | 95.8 % (577 of 602) | 99.0 % (201 of 203) | 92.7 % (280 of 302) | 99.0 % (96 of 97) |
Sidechain | 95.3 % (662 of 695) | 96.2 % (401 of 417) | 93.6 % (250 of 267) | 100.0 % (11 of 11) |
Aromatic | 77.8 % (98 of 126) | 79.4 % (50 of 63) | 75.4 % (46 of 61) | 100.0 % (2 of 2) |
Methyl | 100.0 % (112 of 112) | 100.0 % (56 of 56) | 100.0 % (56 of 56) |
1. MAVS CARD
GSMPFAEDKT YKYICRNFSN FCNVDVVEIL PYLPCLTARD QDRLRATCTL SGNRDTLWHL FNTLQRRPGW VEYFIAALRG CELVDLADEV ASVYQSYQPR TSSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 3, Details 0.3 mM uniformly 13C, 15N-labled MAVS-CARD in 50 mM sodium phosphate buffer with 7% D2O and 1 mM DTT at pH 3.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MAVS CARD | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 3, Details 0.3 mM uniformly 13C, 15N-labled MAVS-CARD in 50 mM sodium phosphate buffer with 7% D2O and 1 mM DTT at pH 3.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MAVS CARD | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 3, Details 0.3 mM uniformly 13C, 15N-labled MAVS-CARD in 50 mM sodium phosphate buffer with 7% D2O and 1 mM DTT at pH 3.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MAVS CARD | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 3, Details 0.3 mM uniformly 13C, 15N-labled MAVS-CARD in 50 mM sodium phosphate buffer with 7% D2O and 1 mM DTT at pH 3.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MAVS CARD | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 3, Details 0.3 mM uniformly 13C, 15N-labled MAVS-CARD in 50 mM sodium phosphate buffer with 7% D2O and 1 mM DTT at pH 3.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MAVS CARD | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 3, Details 0.3 mM uniformly 13C, 15N-labled MAVS-CARD in 50 mM sodium phosphate buffer with 7% D2O and 1 mM DTT at pH 3.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MAVS CARD | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 3, Details 0.3 mM uniformly 13C, 15N-labled MAVS-CARD in 50 mM sodium phosphate buffer with 7% D2O and 1 mM DTT at pH 3.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MAVS CARD | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 3, Details 0.3 mM uniformly 13C, 15N-labled MAVS-CARD in 50 mM sodium phosphate buffer with 7% D2O and 1 mM DTT at pH 3.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MAVS CARD | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 3, Details 0.3 mM uniformly 13C, 15N-labled MAVS-CARD in 50 mM sodium phosphate buffer with 7% D2O and 1 mM DTT at pH 3.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MAVS CARD | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 3, Details 0.3 mM uniformly 13C, 15N-labled MAVS-CARD in 50 mM sodium phosphate buffer with 7% D2O and 1 mM DTT at pH 3.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MAVS CARD | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 3, Details 0.3 mM uniformly 13C, 15N-labled MAVS-CARD in 50 mM sodium phosphate buffer with 7% D2O and 1 mM DTT at pH 3.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MAVS CARD | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 3, Details 0.3 mM uniformly 13C, 15N-labled MAVS-CARD in 50 mM sodium phosphate buffer with 7% D2O and 1 mM DTT at pH 3.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MAVS CARD | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 3, Details 0.3 mM uniformly 13C, 15N-labled MAVS-CARD in 50 mM sodium phosphate buffer with 7% D2O and 1 mM DTT at pH 3.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MAVS CARD | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | sodium phosphate buffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25109_2ms8.nef |
Input source #2: Coordindates | 2ms8.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GSMPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSMPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPR --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 00 TS || TS --
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 102 | 0 | 0 | 100.0 |
Content subtype: combined_25109_2ms8.nef
Assigned chemical shifts
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GSMPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSMPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPR 00 TS || TS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 620 | 599 | 96.6 |
13C chemical shifts | 471 | 428 | 90.9 |
15N chemical shifts | 117 | 116 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 203 | 200 | 98.5 |
13C chemical shifts | 204 | 178 | 87.3 |
15N chemical shifts | 97 | 96 | 99.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 417 | 399 | 95.7 |
13C chemical shifts | 267 | 250 | 93.6 |
15N chemical shifts | 20 | 20 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 56 | 98.2 |
13C chemical shifts | 57 | 56 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 48 | 76.2 |
13C chemical shifts | 61 | 46 | 75.4 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GSMPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SMPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPR 00 TS || TS
Dihedral angle restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GSMPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPR ||||||||||||| |||| |||||| ||||||||||||| ||||||||||| |||||||||| ||||||||||||| ....FAEDKTYKYICRN.SNFC...VVEILP......ARDQDRLRATCTL...RDTLWHLFNTL.....WVEYFIAALR....VDLADEVASVYQS -0--------10--------20--------30--------40--------50--------60--------70--------80--------90---- 00 TS