Ligand-induced folding of a receiver domain
GAMGMPKVLV LEDEPLIAMN LQYAFEDEGA EVVVAATCEQ ALKSLADNPI DVAVLDVNLG PKSHCGPVAD ALKQRAIPFI LHTGDLDRHG ELLRKIDAPV MAKPADTSDV AKRALEMCGG DKEPA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.8 % (1352 of 1369) | 98.9 % (699 of 707) | 98.5 % (532 of 540) | 99.2 % (121 of 122) |
Backbone | 98.4 % (720 of 732) | 98.8 % (247 of 250) | 97.8 % (358 of 366) | 99.1 % (115 of 116) |
Sidechain | 99.3 % (748 of 753) | 98.9 % (452 of 457) | 100.0 % (290 of 290) | 100.0 % (6 of 6) |
Aromatic | 100.0 % (40 of 40) | 100.0 % (20 of 20) | 100.0 % (20 of 20) | |
Methyl | 100.0 % (162 of 162) | 100.0 % (81 of 81) | 100.0 % (81 of 81) |
1. EL LovR
GAMGMPKVLV LEDEPLIAMN LQYAFEDEGA EVVVAATCEQ ALKSLADNPI DVAVLDVNLG PKSHCGPVAD ALKQRAIPFI LHTGDLDRHG ELLRKIDAPV MAKPADTSDV AKRALEMCGG DKEPASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium azide | natural abundance | 3 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | HEPES | natural abundance | 20 mM | |
4 | AEBSF protease inhibitor | natural abundance | 1.8 mg/mL | |
5 | D2O | natural abundance | 10 % | |
6 | EL_LovR | [U-100% 13C; U-100% 15N] | 500 uM | |
7 | Beryllium fluoride | natural abundance | 15 mM | |
8 | Magnesium Chloride | natural abundance | 10 mM | |
9 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium azide | natural abundance | 3 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | HEPES | natural abundance | 20 mM | |
4 | AEBSF protease inhibitor | natural abundance | 1.8 mg/mL | |
5 | D2O | natural abundance | 10 % | |
6 | EL_LovR | [U-100% 13C; U-100% 15N] | 500 uM | |
7 | Beryllium fluoride | natural abundance | 15 mM | |
8 | Magnesium Chloride | natural abundance | 10 mM | |
9 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium azide | natural abundance | 3 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | HEPES | natural abundance | 20 mM | |
4 | AEBSF protease inhibitor | natural abundance | 1.8 mg/mL | |
5 | D2O | natural abundance | 10 % | |
6 | EL_LovR | [U-100% 13C; U-100% 15N] | 500 uM | |
7 | Beryllium fluoride | natural abundance | 15 mM | |
8 | Magnesium Chloride | natural abundance | 10 mM | |
9 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium azide | natural abundance | 3 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | HEPES | natural abundance | 20 mM | |
4 | AEBSF protease inhibitor | natural abundance | 1.8 mg/mL | |
5 | D2O | natural abundance | 10 % | |
6 | EL_LovR | [U-100% 13C; U-100% 15N] | 500 uM | |
7 | Beryllium fluoride | natural abundance | 15 mM | |
8 | Magnesium Chloride | natural abundance | 10 mM | |
9 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium azide | natural abundance | 3 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | HEPES | natural abundance | 20 mM | |
4 | AEBSF protease inhibitor | natural abundance | 1.8 mg/mL | |
5 | D2O | natural abundance | 10 % | |
6 | EL_LovR | [U-100% 13C; U-100% 15N] | 500 uM | |
7 | Beryllium fluoride | natural abundance | 15 mM | |
8 | Magnesium Chloride | natural abundance | 10 mM | |
9 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium azide | natural abundance | 3 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | HEPES | natural abundance | 20 mM | |
4 | AEBSF protease inhibitor | natural abundance | 1.8 mg/mL | |
5 | D2O | natural abundance | 10 % | |
6 | EL_LovR | [U-100% 13C; U-100% 15N] | 500 uM | |
7 | Beryllium fluoride | natural abundance | 15 mM | |
8 | Magnesium Chloride | natural abundance | 10 mM | |
9 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium azide | natural abundance | 3 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | HEPES | natural abundance | 20 mM | |
4 | AEBSF protease inhibitor | natural abundance | 1.8 mg/mL | |
5 | D2O | natural abundance | 10 % | |
6 | EL_LovR | [U-100% 13C; U-100% 15N] | 500 uM | |
7 | Beryllium fluoride | natural abundance | 15 mM | |
8 | Magnesium Chloride | natural abundance | 10 mM | |
9 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium azide | natural abundance | 3 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | HEPES | natural abundance | 20 mM | |
4 | AEBSF protease inhibitor | natural abundance | 1.8 mg/mL | |
5 | D2O | natural abundance | 10 % | |
6 | EL_LovR | [U-100% 13C; U-100% 15N] | 500 uM | |
7 | Beryllium fluoride | natural abundance | 15 mM | |
8 | Magnesium Chloride | natural abundance | 10 mM | |
9 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium azide | natural abundance | 3 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | HEPES | natural abundance | 20 mM | |
4 | AEBSF protease inhibitor | natural abundance | 1.8 mg/mL | |
5 | D2O | natural abundance | 10 % | |
6 | EL_LovR | [U-100% 13C; U-100% 15N] | 500 uM | |
7 | Beryllium fluoride | natural abundance | 15 mM | |
8 | Magnesium Chloride | natural abundance | 10 mM | |
9 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium azide | natural abundance | 3 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | HEPES | natural abundance | 20 mM | |
4 | AEBSF protease inhibitor | natural abundance | 1.8 mg/mL | |
5 | D2O | natural abundance | 10 % | |
6 | EL_LovR | [U-100% 13C; U-100% 15N] | 500 uM | |
7 | Beryllium fluoride | natural abundance | 15 mM | |
8 | Magnesium Chloride | natural abundance | 10 mM | |
9 | H2O | natural abundance | 90 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium azide | natural abundance | 3 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | HEPES | natural abundance | 20 mM | |
4 | AEBSF protease inhibitor | natural abundance | 1.8 mg/mL | |
5 | D2O | natural abundance | 10 % | |
6 | EL_LovR | [U-100% 13C; U-100% 15N] | 500 uM | |
7 | Beryllium fluoride | natural abundance | 15 mM | |
8 | Magnesium Chloride | natural abundance | 10 mM | |
9 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_25137_2msw.nef |
Input source #2: Coordindates | 2msw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGMPKVLVLEDEPLIAMNLQYAFEDEGAEVVVAATCEQALKSLADNPIDVAVLDVNLGPKSHCGPVADALKQRAIPFILHTGDLDRHGELLRKIDAPV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGMPKVLVLEDEPLIAMNLQYAFEDEGAEVVVAATCEQALKSLADNPIDVAVLDVNLGPKSHCGPVADALKQRAIPFILHTGDLDRHGELLRKIDAPV -------110-------120----- MAKPADTSDVAKRALEMCGGDKEPA ||||||||||||||||||||||||| MAKPADTSDVAKRALEMCGGDKEPA
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 125 | 0 | 0 | 100.0 |
Content subtype: combined_25137_2msw.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGMPKVLVLEDEPLIAMNLQYAFEDEGAEVVVAATCEQALKSLADNPIDVAVLDVNLGPKSHCGPVADALKQRAIPFILHTGDLDRHGELLRKIDAPV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGMPKVLVLEDEPLIAMNLQYAFEDEGAEVVVAATCEQALKSLADNPIDVAVLDVNLGPKSHCGPVADALKQRAIPFILHTGDLDRHGELLRKIDAPV -------110-------120----- MAKPADTSDVAKRALEMCGGDKEPA ||||||||||||||||||||||||| MAKPADTSDVAKRALEMCGGDKEPA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
37 | THR | HG1 | 5.63 |
65 | CYS | HG | 1.114 |
83 | THR | HG1 | 6.56 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 707 | 702 | 99.3 |
13C chemical shifts | 540 | 530 | 98.1 |
15N chemical shifts | 126 | 121 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 250 | 249 | 99.6 |
13C chemical shifts | 250 | 240 | 96.0 |
15N chemical shifts | 116 | 115 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 457 | 453 | 99.1 |
13C chemical shifts | 290 | 290 | 100.0 |
15N chemical shifts | 10 | 6 | 60.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 86 | 86 | 100.0 |
13C chemical shifts | 86 | 86 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 20 | 20 | 100.0 |
13C chemical shifts | 20 | 20 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGMPKVLVLEDEPLIAMNLQYAFEDEGAEVVVAATCEQALKSLADNPIDVAVLDVNLGPKSHCGPVADALKQRAIPFILHTGDLDRHGELLRKIDAPV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGMPKVLVLEDEPLIAMNLQYAFEDEGAEVVVAATCEQALKSLADNPIDVAVLDVNLGPKSHCGPVADALKQRAIPFILHTGDLDRHGELLRKIDAPV -------110-------120----- MAKPADTSDVAKRALEMCGGDKEPA ||||||||||||||||||||||||| MAKPADTSDVAKRALEMCGGDKEPA