Struture of -24 DNA binding domain of sigma 54 from E. coli
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.6 % (768 of 953) | 81.7 % (405 of 496) | 78.2 % (290 of 371) | 84.9 % (73 of 86) |
Backbone | 81.7 % (405 of 496) | 87.3 % (144 of 165) | 74.9 % (188 of 251) | 91.3 % (73 of 80) |
Sidechain | 80.4 % (434 of 540) | 78.9 % (261 of 331) | 85.2 % (173 of 203) | 0.0 % (0 of 6) |
Aromatic | 25.0 % (8 of 32) | 25.0 % (4 of 16) | 25.0 % (4 of 16) | |
Methyl | 94.3 % (100 of 106) | 94.3 % (50 of 53) | 94.3 % (50 of 53) |
1. entity
EASSTAIRAL VKKLIAAENP AKPLSDSKLT SLLSEQGIMV ARRTVAKYRE SLSIPPSNQR KQLVANSSSV DKLAAALEHH HHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | 0.0 ~ 0.0 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25147_2mt3.nef |
Input source #2: Coordindates | 2mt3.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----420-------430-------440-------450-------460-------470-------480-------490------- EASSTAIRALVKKLIAAENPAKPLSDSKLTSLLSEQGIMVARRTVAKYRESLSIPPSNQRKQLVANSSSVDKLAAALEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| EASSTAIRALVKKLIAAENPAKPLSDSKLTSLLSEQGIMVARRTVAKYRESLSIPPSNQRKQLVANSSSVDKLAAALEHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 84 | 0 | 0 | 100.0 |
Content subtype: combined_25147_2mt3.nef
Assigned chemical shifts
----420-------430-------440-------450-------460-------470-------480-------490------- EASSTAIRALVKKLIAAENPAKPLSDSKLTSLLSEQGIMVARRTVAKYRESLSIPPSNQRKQLVANSSSVDKLAAALEHHHHHH |||||| |||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||| |||||||||| .ASSTAI.ALVKKLIAAENPAKPLSD.KLTSLLSEQGIMVARRTVAKYRESLSIPPSNQRKQLVANSS.VDKLAAALEH ----420-------430-------440-------450-------460-------470-------480-------490--
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 496 | 408 | 82.3 |
13C chemical shifts | 371 | 281 | 75.7 |
15N chemical shifts | 91 | 71 | 78.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 165 | 144 | 87.3 |
13C chemical shifts | 168 | 114 | 67.9 |
15N chemical shifts | 80 | 71 | 88.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 331 | 264 | 79.8 |
13C chemical shifts | 203 | 167 | 82.3 |
15N chemical shifts | 11 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 47 | 87.0 |
13C chemical shifts | 54 | 47 | 87.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 16 | 4 | 25.0 |
13C chemical shifts | 16 | 4 | 25.0 |
Distance restraints
----420-------430-------440-------450-------460-------470-------480-------490------- EASSTAIRALVKKLIAAENPAKPLSDSKLTSLLSEQGIMVARRTVAKYRESLSIPPSNQRKQLVANSSSVDKLAAALEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| EASSTAIRALVKKLIAAENPAKPLSDSKLTSLLSEQGIMVARRTVAKYRESLSIPPSNQRKQLVANS..VDKLAAALE ----420-------430-------440-------450-------460-------470-------480-------490-
Dihedral angle restraints
----420-------430-------440-------450-------460-------470-------480-------490------- EASSTAIRALVKKLIAAENPAKPLSDSKLTSLLSEQGIMVARRTVAKYRESLSIPPSNQRKQLVANSSSVDKLAAALEHHHHHH |||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||| ||||||||||||||| EASSTAIRALVKKLIAAENPAKPLSDSKLTSLLSEQ...VARRTVAKYRESLSIPPSNQRKQ..ANSSSVDKLAAALEH ----420-------430-------440-------450-------460-------470-------480-------490--