NTD-NUSA
MSSELLDALT ILEKEKGISK EIIIEAIEAA LISAYKRNFN QAQNVRVDLN RETGSIRVFA RKDVVDEVYD QRLEISIEEA QGIHPEYMVG DVVEIEVTPK DFGRIAAQTA KQVVTQRVRE AERG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.5 % (1363 of 1443) | 94.3 % (709 of 752) | 95.3 % (532 of 558) | 91.7 % (122 of 133) |
Backbone | 93.6 % (693 of 740) | 93.7 % (236 of 252) | 94.5 % (346 of 366) | 91.0 % (111 of 122) |
Sidechain | 95.5 % (784 of 821) | 94.6 % (473 of 500) | 96.8 % (300 of 310) | 100.0 % (11 of 11) |
Aromatic | 100.0 % (58 of 58) | 100.0 % (29 of 29) | 100.0 % (29 of 29) | |
Methyl | 100.0 % (166 of 166) | 100.0 % (83 of 83) | 100.0 % (83 of 83) |
1. NTD-NUSA
MSSELLDALT ILEKEKGISK EIIIEAIEAA LISAYKRNFN QAQNVRVDLN RETGSIRVFA RKDVVDEVYD QRLEISIEEA QGIHPEYMVG DVVEIEVTPK DFGRIAAQTA KQVVTQRVRE AERGSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NTD-NUSA | [U-99% 13C; U-99% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 900 MHz Equipped with cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NTD-NUSA | [U-99% 13C; U-99% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz Equipped with cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NTD-NUSA | [U-99% 13C; U-99% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz Equipped with cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NTD-NUSA | [U-99% 13C; U-99% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz Equipped with cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NTD-NUSA | [U-99% 13C; U-99% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz Equipped with cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NTD-NUSA | [U-99% 13C; U-99% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz Equipped with cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NTD-NUSA | [U-99% 13C; U-99% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz Equipped with cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NTD-NUSA | [U-99% 13C; U-99% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz Equipped with cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NTD-NUSA | [U-99% 13C; U-99% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz Equipped with cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NTD-NUSA | [U-99% 13C; U-99% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz Equipped with cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NTD-NUSA | [U-99% 13C; U-99% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Bruker Avance - 900 MHz Equipped with cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NTD-NUSA | [U-99% 13C; U-99% 15N] | 400 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25148_2mt4.nef |
Input source #2: Coordindates | 2mt4.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSSELLDALTILEKEKGISKEIIIEAIEAALISAYKRNFNQAQNVRVDLNRETGSIRVFARKDVVDEVYDQRLEISIEEAQGIHPEYMVGDVVEIEVTPK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSSELLDALTILEKEKGISKEIIIEAIEAALISAYKRNFNQAQNVRVDLNRETGSIRVFARKDVVDEVYDQRLEISIEEAQGIHPEYMVGDVVEIEVTPK -------110-------120---- DFGRIAAQTAKQVVTQRVREAERG |||||||||||||||||||||||| DFGRIAAQTAKQVVTQRVREAERG
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 124 | 0 | 0 | 100.0 |
Content subtype: combined_25148_2mt4.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSSELLDALTILEKEKGISKEIIIEAIEAALISAYKRNFNQAQNVRVDLNRETGSIRVFARKDVVDEVYDQRLEISIEEAQGIHPEYMVGDVVEIEVTPK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...ELLDALTILEKEKGISKEIIIEAIEAALISAYKRNFNQAQNVRVDLNRETGSIRVFARKDVVDEVYDQRLEISIEEAQGIHPEYMVGDVVEIEVTPK -------110-------120---- DFGRIAAQTAKQVVTQRVREAERG |||||||||||||||||||||||| DFGRIAAQTAKQVVTQRVREAERG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 752 | 710 | 94.4 |
13C chemical shifts | 558 | 530 | 95.0 |
15N chemical shifts | 143 | 121 | 84.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 252 | 237 | 94.0 |
13C chemical shifts | 248 | 229 | 92.3 |
15N chemical shifts | 122 | 110 | 90.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 500 | 473 | 94.6 |
13C chemical shifts | 310 | 301 | 97.1 |
15N chemical shifts | 21 | 11 | 52.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 85 | 84 | 98.8 |
13C chemical shifts | 85 | 84 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 29 | 29 | 100.0 |
13C chemical shifts | 29 | 29 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSSELLDALTILEKEKGISKEIIIEAIEAALISAYKRNFNQAQNVRVDLNRETGSIRVFARKDVVDEVYDQRLEISIEEAQGIHPEYMVGDVVEIEVTPK ||||||||||||| |||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...ELLDALTILEKEK.ISKEIIIEAIEAALISAYKRNF.QAQNVRVDLNRETGSIRVFARKDVVDEVYDQRLEISIEEAQGIHPEYMVGDVVEIEVTPK -------110-------120---- DFGRIAAQTAKQVVTQRVREAERG |||||||||||||||||||||||| DFGRIAAQTAKQVVTQRVREAERG
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSSELLDALTILEKEKGISKEIIIEAIEAALISAYKRNFNQAQNVRVDLNRETGSIRVFARKDVVDEVYDQRLEISIEEAQGIHPEYMVGDVVEIEVTPK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..SELLDALTILEKEKGISKEIIIEAIEAALISAYKRNFNQAQNVRVDLNRETGSIRVFARKDVVDEVYDQRLEISIEEAQGIHPEYMVGDVVEIEVTPK -------110-------120---- DFGRIAAQTAKQVVTQRVREAERG |||||||||||||||||||||||| DFGRIAAQTAKQVVTQRVREAERG