Solution structure of the La motif of human LARP6
TASGGENERE DLEQEWKPPD EELIKKLVDQ IEFYFSDENL EKDAFLLKHV RRNKLGYVSV KLLTSFKKVK HLTRDWRTTA HALKYSVVLE LNEDHRKVRR TTPVPLFPNE NLPS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.1 % (1114 of 1409) | 77.0 % (571 of 742) | 80.3 % (441 of 549) | 86.4 % (102 of 118) |
Backbone | 91.5 % (615 of 672) | 93.3 % (210 of 225) | 90.3 % (306 of 339) | 91.7 % (99 of 108) |
Sidechain | 71.1 % (603 of 848) | 69.8 % (361 of 517) | 74.5 % (239 of 321) | 30.0 % (3 of 10) |
Aromatic | 32.5 % (37 of 114) | 31.6 % (18 of 57) | 30.9 % (17 of 55) | 100.0 % (2 of 2) |
Methyl | 99.2 % (125 of 126) | 98.4 % (62 of 63) | 100.0 % (63 of 63) |
1. entity
TASGGENERE DLEQEWKPPD EELIKKLVDQ IEFYFSDENL EKDAFLLKHV RRNKLGYVSV KLLTSFKKVK HLTRDWRTTA HALKYSVVLE LNEDHRKVRR TTPVPLFPNE NLPSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6-LaM | [U-95% 13C; U-95% 15N] | 0.4 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | L-Arginine | natural abundance | 50 mM | |
6 | L-Glutamic acid | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.101329 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6-LaM | [U-95% 13C; U-95% 15N] | 0.4 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | L-Arginine | natural abundance | 50 mM | |
6 | L-Glutamic acid | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6-LaM | [U-95% 13C; U-95% 15N] | 0.4 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | L-Arginine | natural abundance | 50 mM | |
6 | L-Glutamic acid | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6-LaM | [U-95% 13C; U-95% 15N] | 0.4 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | L-Arginine | natural abundance | 50 mM | |
6 | L-Glutamic acid | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6-LaM | [U-95% 13C; U-95% 15N] | 0.4 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | L-Arginine | natural abundance | 50 mM | |
6 | L-Glutamic acid | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6-LaM | [U-95% 13C; U-95% 15N] | 0.4 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | L-Arginine | natural abundance | 50 mM | |
6 | L-Glutamic acid | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6-LaM | [U-95% 13C; U-95% 15N] | 0.4 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | L-Arginine | natural abundance | 50 mM | |
6 | L-Glutamic acid | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6-LaM | [U-95% 13C; U-95% 15N] | 0.4 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | L-Arginine | natural abundance | 50 mM | |
6 | L-Glutamic acid | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6-LaM | [U-95% 13C; U-95% 15N] | 0.4 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | L-Arginine | natural abundance | 50 mM | |
6 | L-Glutamic acid | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6-LaM | [U-95% 13C; U-95% 15N] | 0.4 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | L-Arginine | natural abundance | 50 mM | |
6 | L-Glutamic acid | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6-LaM | [U-95% 13C; U-95% 15N] | 0.4 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | L-Arginine | natural abundance | 50 mM | |
6 | L-Glutamic acid | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25159_2mtf.nef |
Input source #2: Coordindates | 2mtf.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-70-------80--------90-------100-------110-------120-------130-------140-------150-------160-------1 GTASGGENEREDLEQEWKPPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVRRNKLGYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVVLELNEDHRKVR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GTASGGENEREDLEQEWKPPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVRRNKLGYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVVLELNEDHRKVR --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 70-------180--- RTTPVPLFPNENLPS ||||||||||||||| RTTPVPLFPNENLPS -------110-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 115 | 0 | 0 | 100.0 |
Content subtype: combined_25159_2mtf.nef
Assigned chemical shifts
-70-------80--------90-------100-------110-------120-------130-------140-------150-------160-------1 GTASGGENEREDLEQEWKPPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVRRNKLGYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVVLELNEDHRKVR ||||||||||||| |||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||| .TASGGENEREDLE.EWKPPDEELIKKLVDQIEFYFSDENLEKDAFLLKHV....LGYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVVLELNEDHRKVR 70-------180--- RTTPVPLFPNENLPS ||||||||||||||| RTTPVPLFPNENLPS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 745 | 545 | 73.2 |
13C chemical shifts | 551 | 416 | 75.5 |
15N chemical shifts | 127 | 98 | 77.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 228 | 206 | 90.4 |
13C chemical shifts | 230 | 190 | 82.6 |
15N chemical shifts | 109 | 96 | 88.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 517 | 339 | 65.6 |
13C chemical shifts | 321 | 226 | 70.4 |
15N chemical shifts | 18 | 2 | 11.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 62 | 98.4 |
13C chemical shifts | 63 | 63 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 17 | 29.8 |
13C chemical shifts | 55 | 16 | 29.1 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
-70-------80--------90-------100-------110-------120-------130-------140-------150-------160-------1 GTASGGENEREDLEQEWKPPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVRRNKLGYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVVLELNEDHRKVR | |||| || ||||||||||||||||||||||||||||| || |||| ||||| |||||||||||||||||||||||||||||||| .....G...REDL...WK.PDEELIKKLVDQIEFYFSDENLEKDAFLL.HV......YVSV.LLTSF.KVKHLTRDWRTTAHALKYSVVLELNEDHRKVR 70-------180--- RTTPVPLFPNENLPS ||||| || |||| | RTTPV.LF.NENL.S
Dihedral angle restraints
-70-------80--------90-------100-------110-------120-------130-------140-------150-------160-------1 GTASGGENEREDLEQEWKPPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVRRNKLGYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVVLELNEDHRKVR ||| |||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||| ....GGE.......QEWKPPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVR..KLGYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVVLELNEDHRKVR -70-------80--------90-------100-------110-------120-------130-------140-------150-------160-------1 70-------180--- RTTPVPLFPNENLPS |||||||||||| RTTPVPLFPNEN 70-------180