NMR structure of the RRM1 of human LARP6
NLPSKMLLVY DLYLSPKLWA LATPQKNGRV QEKVMEHLLK LFGTFGVISS VRILKPGREL PPDIRRISSR YSQVGTQECA IVEFEEVEAA IKAHEFMITE SQGKENMKAV LIGMKP
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.9 % (1137 of 1405) | 77.8 % (574 of 738) | 83.4 % (458 of 549) | 89.0 % (105 of 118) |
Backbone | 91.3 % (623 of 682) | 90.9 % (211 of 232) | 90.9 % (310 of 341) | 93.6 % (102 of 109) |
Sidechain | 74.0 % (616 of 832) | 71.7 % (363 of 506) | 78.9 % (250 of 317) | 33.3 % (3 of 9) |
Aromatic | 88.1 % (74 of 84) | 88.1 % (37 of 42) | 87.8 % (36 of 41) | 100.0 % (1 of 1) |
Methyl | 85.2 % (121 of 142) | 88.7 % (63 of 71) | 81.7 % (58 of 71) |
1. LARP6 RRM1
NLPSKMLLVY DLYLSPKLWA LATPQKNGRV QEKVMEHLLK LFGTFGVISS VRILKPGREL PPDIRRISSR YSQVGTQECA IVEFEEVEAA IKAHEFMITE SQGKENMKAV LIGMKPSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6 RRM1 | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.101329 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6 RRM1 | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6 RRM1 | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6 RRM1 | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6 RRM1 | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6 RRM1 | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6 RRM1 | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6 RRM1 | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6 RRM1 | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP6 RRM1 | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_25160_2mtg.nef |
Input source #2: Coordindates | 2mtg.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---180-----190-------200-------210-------220-------230-------240-------250-------260-------270------ GNENLPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFM |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GNENLPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFM --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -280-------290----- ITESQGKENMKAVLIGMKP ||||||||||||||||||| ITESQGKENMKAVLIGMKP -------110---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 119 | 0 | 0 | 100.0 |
Content subtype: combined_25160_2mtg.nef
Assigned chemical shifts
---180-----190-------200-------210-------220-------230-------240-------250-------260-------270------ GNENLPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFM ||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...NLPSKMLLVYDLYLSPKLWALAT...NGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFM ---180-----190-------200-------210-------220-------230-------240-------250-------260-------270------ -280-------290----- ITESQGKENMKAVLIGMKP |||||||||||||||||| ITESQGKENMKAVLIGMK -280-------290----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 753 | 559 | 74.2 |
13C chemical shifts | 558 | 461 | 82.6 |
15N chemical shifts | 128 | 104 | 81.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 239 | 213 | 89.1 |
13C chemical shifts | 238 | 211 | 88.7 |
15N chemical shifts | 112 | 103 | 92.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 514 | 346 | 67.3 |
13C chemical shifts | 320 | 250 | 78.1 |
15N chemical shifts | 16 | 1 | 6.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 76 | 65 | 85.5 |
13C chemical shifts | 76 | 66 | 86.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 36 | 85.7 |
13C chemical shifts | 41 | 35 | 85.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
---180-----190-------200-------210-------220-------230-------240-------250-------260-------270------ GNENLPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFM |||||||||||||| ||||||| |||||||||||||||||||||||||||||||| ||| ||||| ||||||||||||||||||||||||| ....LPSKMLLVYDLYLS.KLWALAT......VQEKVMEHLLKLFGTFGVISSVRILKPGRELP.DIR.ISSRY.QVGTQECAIVEFEEVEAAIKAHEFM ---180-----190-------200-------210-------220-------230-------240-------250-------260-------270------ -280-------290----- ITESQGKENMKAVLIGMKP |||||||||||||||| ITESQGKENMKAVLIG -280-------290--
Dihedral angle restraints
---180-----190-------200-------210-------220-------230-------240-------250-------260-------270------ GNENLPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFM |||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...NLPSKMLLVYDLYLSPKLWALATP...GRVQEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFM ---180-----190-------200-------210-------220-------230-------240-------250-------260-------270------ -280-------290----- ITESQGKENMKAVLIGMKP |||||||||||||||| ITESQGKENMKAVLIG -280-------290--
RDC restraints