Solution NMR Structure of DE NOVO DESIGNED DE NOVO DESIGNED FR55, Northeast Structural Genomics Consortium (NESG) Target OR109
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.8 % (974 of 1038) | 94.5 % (512 of 542) | 93.1 % (377 of 405) | 93.4 % (85 of 91) |
Backbone | 94.1 % (495 of 526) | 95.0 % (172 of 181) | 93.8 % (242 of 258) | 93.1 % (81 of 87) |
Sidechain | 93.8 % (557 of 594) | 94.2 % (340 of 361) | 93.0 % (213 of 229) | 100.0 % (4 of 4) |
Aromatic | 68.6 % (48 of 70) | 68.6 % (24 of 35) | 68.6 % (24 of 35) | |
Methyl | 100.0 % (100 of 100) | 100.0 % (50 of 50) | 100.0 % (50 of 50) |
1. OR109
MGEMDIRFRG DDLEALEKAL KEMIRQARKF AGTVTYTLDG NDLEIRITGV PEQVRKELAK EAERLAKEFN ITVTYTIRGS LEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 4.5, Details 1.01 mM OR109.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR109 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 4.5, Details 1.01 mM OR109.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR109 | [U-5% 13C; U-5% 15N] | 1.01 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Pressure 1 atm, Temperature 308 K, pH 4.5
Experiment name 2D 1H-15N HSQC
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 4.5, Details 1.01 mM OR109.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR109 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 4.5, Details 1.01 mM OR109.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR109 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 4.5, Details 1.01 mM OR109.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR109 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 4.5, Details 1.01 mM OR109.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR109 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 4.5, Details 1.01 mM OR109.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR109 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 4.5, Details 1.01 mM OR109.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR109 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 4.5, Details 1.01 mM OR109.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR109 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 4.5, Details 1.01 mM OR109.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR109 | [U-100% 13C; U-100% 15N] | 1.01 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz Rutgers
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 4.5, Details 1.01 mM OR109.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR109 | [U-5% 13C; U-5% 15N] | 1.01 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz UGA
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 4.5, Details 1.01 mM OR109.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR109 | [U-5% 13C; U-5% 15N] | 1.01 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25165_2mtl.nef |
Input source #2: Coordindates | 2mtl.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80-------- MGEMDIRFRGDDLEALEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRGSLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGEMDIRFRGDDLEALEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRGSLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 88 | 0 | 0 | 100.0 |
Content subtype: combined_25165_2mtl.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80-------- MGEMDIRFRGDDLEALEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRGSLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGEMDIRFRGDDLEALEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRGSLEHH --------10--------20--------30--------40--------50--------60--------70--------80----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 542 | 510 | 94.1 |
13C chemical shifts | 405 | 377 | 93.1 |
15N chemical shifts | 99 | 92 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 181 | 170 | 93.9 |
13C chemical shifts | 176 | 164 | 93.2 |
15N chemical shifts | 87 | 81 | 93.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 361 | 340 | 94.2 |
13C chemical shifts | 229 | 213 | 93.0 |
15N chemical shifts | 12 | 11 | 91.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 52 | 98.1 |
13C chemical shifts | 53 | 52 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 24 | 68.6 |
13C chemical shifts | 35 | 24 | 68.6 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80-------- MGEMDIRFRGDDLEALEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRGSLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..EMDIRFRGDDLEALEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRGSLEH --------10--------20--------30--------40--------50--------60--------70--------80---
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80-------- MGEMDIRFRGDDLEALEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRGSLEHHHHHH ||||||||| |||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||| .GEMDIRFRG.DLEALEKALKEMIRQARKFAGTVTYTLDGNDLEIRITG.PEQVRKELAKEAERLAKEFNITVTYTIRG --------10--------20--------30--------40--------50--------60--------70---------