NMR resonance assignment of the C-terminal domain of the lantibiotic immunity protein NisI
SDKGAVKALR LQNFDVTSDI SDDNFVIDKN DSRKIDYMGN IYSISDTTVS DEELGEYQDV LAEVRVFDSV SGKSIPRSEW GRIDKDGSNS KQSRTEWDYG EIHSIRGKSL TEAFAVEIND DFKLATKVGN
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.4 % (1405 of 1472) | 94.6 % (722 of 763) | 96.0 % (545 of 568) | 97.9 % (138 of 141) |
Backbone | 98.5 % (766 of 778) | 98.1 % (263 of 268) | 98.7 % (376 of 381) | 98.4 % (127 of 129) |
Sidechain | 92.1 % (751 of 815) | 91.9 % (455 of 495) | 92.9 % (286 of 308) | 83.3 % (10 of 12) |
Aromatic | 83.6 % (92 of 110) | 85.5 % (47 of 55) | 81.1 % (43 of 53) | 100.0 % (2 of 2) |
Methyl | 96.9 % (124 of 128) | 96.9 % (62 of 64) | 96.9 % (62 of 64) |
1. NisI
SDKGAVKALR LQNFDVTSDI SDDNFVIDKN DSRKIDYMGN IYSISDTTVS DEELGEYQDV LAEVRVFDSV SGKSIPRSEW GRIDKDGSNS KQSRTEWDYG EIHSIRGKSL TEAFAVEIND DFKLATKVGNSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DSS | natural abundance | 30 uM | |
4 | NisI97-226 | [U-15N] | 400 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 30 uM | |
10 | NisI97-226 | [U-13C; U-15N] | 400 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DSS | natural abundance | 30 uM | |
4 | NisI97-226 | [U-15N] | 400 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 30 uM | |
10 | NisI97-226 | [U-13C; U-15N] | 400 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 30 uM | |
10 | NisI97-226 | [U-13C; U-15N] | 400 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 30 uM | |
10 | NisI97-226 | [U-13C; U-15N] | 400 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 30 uM | |
10 | NisI97-226 | [U-13C; U-15N] | 400 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 30 uM | |
10 | NisI97-226 | [U-13C; U-15N] | 400 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 30 uM | |
10 | NisI97-226 | [U-13C; U-15N] | 400 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 30 uM | |
10 | NisI97-226 | [U-13C; U-15N] | 400 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 30 uM | |
10 | NisI97-226 | [U-13C; U-15N] | 400 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DSS | natural abundance | 30 uM | |
4 | NisI97-226 | [U-15N] | 400 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 30 uM | |
10 | NisI97-226 | [U-13C; U-15N] | 400 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 30 uM | |
10 | NisI97-226 | [U-13C; U-15N] | 400 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 30 uM | |
10 | NisI97-226 | [U-13C; U-15N] | 400 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_25194_2n2e.nef |
Input source #2: Coordindates | 2n2e.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--100-----110-------120-------130-------140-------150-------160-------170-------180-------190------- DKGAVKALRLQNFDVTSDISDDNFVIDKNDSRKIDYMGNIYSISDTTVSDEELGEYQDVLAEVRVFDSVSGKSIPRSEWGRIDKDGSNSKQSRTEWDYGE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| DKGAVKALRLQNFDVTSDISDDNFVIDKNDSRKIDYMGNIYSISDTTVSDEELGEYQDVLAEVRVFDSVSGKSIPRSEWGRIDKDGSNSKQSRTEWDYGE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 200-------210-------220------ IHSIRGKSLTEAFAVEINDDFKLATKVGN ||||||||||||||||||||||||||||| IHSIRGKSLTEAFAVEINDDFKLATKVGN -------110-------120---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 129 | 0 | 0 | 100.0 |
Content subtype: combined_25194_2n2e.nef
Assigned chemical shifts
--100-----110-------120-------130-------140-------150-------160-------170-------180-------190------- DKGAVKALRLQNFDVTSDISDDNFVIDKNDSRKIDYMGNIYSISDTTVSDEELGEYQDVLAEVRVFDSVSGKSIPRSEWGRIDKDGSNSKQSRTEWDYGE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| DKGAVKALRLQNFDVTSDISDDNFVIDKNDSRKIDYMGNIYSISDTTVSDEELGEYQDVLAEVRVFDSVSGKSIPRSEWGRIDKDGSNSKQSRTEWDYGE 200-------210-------220------ IHSIRGKSLTEAFAVEINDDFKLATKVGN ||||||||||||||||||||||||||||| IHSIRGKSLTEAFAVEINDDFKLATKVGN
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 759 | 710 | 93.5 |
13C chemical shifts | 565 | 537 | 95.0 |
15N chemical shifts | 147 | 138 | 93.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 266 | 265 | 99.6 |
13C chemical shifts | 258 | 257 | 99.6 |
15N chemical shifts | 128 | 127 | 99.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 493 | 445 | 90.3 |
13C chemical shifts | 307 | 280 | 91.2 |
15N chemical shifts | 19 | 11 | 57.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 63 | 96.9 |
13C chemical shifts | 65 | 62 | 95.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 45 | 81.8 |
13C chemical shifts | 53 | 43 | 81.1 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--100-----110-------120-------130-------140-------150-------160-------170-------180-------190------- DKGAVKALRLQNFDVTSDISDDNFVIDKNDSRKIDYMGNIYSISDTTVSDEELGEYQDVLAEVRVFDSVSGKSIPRSEWGRIDKDGSNSKQSRTEWDYGE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....................DNFVIDKNDSRKIDYMGNIYSISDTTVSDEELGEYQDVLAEVRVFDSVSGKSIPRSEWGRIDKDGSNSKQSRTEWDYGE 200-------210-------220------ IHSIRGKSLTEAFAVEINDDFKLATKVGN ||||||||||||||||||||||||||||| IHSIRGKSLTEAFAVEINDDFKLATKVGN
Dihedral angle restraints
--100-----110-------120-------130-------140-------150-------160-------170-------180-------190------- DKGAVKALRLQNFDVTSDISDDNFVIDKNDSRKIDYMGNIYSISDTTVSDEELGEYQDVLAEVRVFDSVSGKSIPRSEWGRIDKDGSNSKQSRTEWDYGE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| ......................NFVIDKNDSRKIDYMGNIYSISDTTVSDEELGEYQDVLAEVRVFDSVSGKSIPRSEWG...........SRTEWDYGE --100-----110-------120-------130-------140-------150-------160-------170-------180-------190------- 200-------210-------220------ IHSIRGKSLTEAFAVEINDDFKLATKVGN |||||||||||||||||||||||||||| IHSIRGKSLTEAFAVEINDDFKLATKVG 200-------210-------220-----
RDC restraints
--100-----110-------120-------130-------140-------150-------160-------170-------180-------190------- DKGAVKALRLQNFDVTSDISDDNFVIDKNDSRKIDYMGNIYSISDTTVSDEELGEYQDVLAEVRVFDSVSGKSIPRSEWGRIDKDGSNSKQSRTEWDYGE |||| ||||||||||| ||| | |||||||| | |||||||| | |||||| | || || ||| .......................FVID.NDSRKIDYMGN.YSI.D.TVSDEELG.Y.DVLAEVRV.D.VSGKSI..S.WG..............EW.YGE --100-----110-------120-------130-------140-------150-------160-------170-------180-------190------- 200-------210-------220------ IHSIRGKSLTEAFAVEINDDFKLATKVGN |||| |||||| ||||||||||||||| IHSI.GKSLTE.FAVEINDDFKLATKV 200-------210-------220----