Solution structure of a putative arsenate reductase from Brucella melitensis. Seattle Structural Genomics Center for Infectious Disease target BrabA.00073.a
MAHHHHHHMG TLEAQTQGPG SMDVTIYHNP VCGTSRKVLG MIREAGIEPH VIEYMKTPLP RDMLVELLRQ MAISPRALLR AKEARYAELG LDDPALSDEV LIDAMISNPV LMNRPVVVTP KGVRLCRPAE TVQELL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.3 % (1296 of 1556) | 80.0 % (648 of 810) | 86.5 % (531 of 614) | 88.6 % (117 of 132) |
Backbone | 87.7 % (696 of 794) | 86.2 % (232 of 269) | 88.0 % (352 of 400) | 89.6 % (112 of 125) |
Sidechain | 80.7 % (718 of 890) | 76.9 % (416 of 541) | 86.8 % (297 of 342) | 71.4 % (5 of 7) |
Aromatic | 51.8 % (29 of 56) | 53.6 % (15 of 28) | 50.0 % (14 of 28) | |
Methyl | 88.1 % (155 of 176) | 84.1 % (74 of 88) | 92.0 % (81 of 88) |
1. entity
MAHHHHHHMG TLEAQTQGPG SMDVTIYHNP VCGTSRKVLG MIREAGIEPH VIEYMKTPLP RDMLVELLRQ MAISPRALLR AKEARYAELG LDDPALSDEV LIDAMISNPV LMNRPVVVTP KGVRLCRPAE TVQELLSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
8 | sodium chloride | natural abundance | 100 (±5.0) mM | |
9 | TRIS | natural abundance | 20 (±1.0) mM | |
10 | DTT | natural abundance | 1 (±0.2) mM | |
11 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
8 | sodium chloride | natural abundance | 100 (±5.0) mM | |
9 | TRIS | natural abundance | 20 (±1.0) mM | |
10 | DTT | natural abundance | 1 (±0.2) mM | |
11 | D2O | natural abundance | 100 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25195_2mu0.nef |
Input source #2: Coordindates | 2mu0.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHMGTLEAQTQGPGSMDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKTPLPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAHHHHHHMGTLEAQTQGPGSMDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKTPLPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEV -------110-------120-------130------ LIDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL |||||||||||||||||||||||||||||||||||| LIDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 136 | 0 | 0 | 100.0 |
Content subtype: combined_25195_2mu0.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHMGTLEAQTQGPGSMDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKTPLPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........MGTLEAQTQGPGSMDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKTPLPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEV -------110-------120-------130------ LIDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL |||||||||||||||||||||||||||||||||||| LIDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 614 | 524 | 85.3 |
1H chemical shifts | 810 | 639 | 78.9 |
15N chemical shifts | 142 | 115 | 81.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 272 | 227 | 83.5 |
1H chemical shifts | 269 | 230 | 85.5 |
15N chemical shifts | 125 | 111 | 88.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 342 | 297 | 86.8 |
1H chemical shifts | 541 | 409 | 75.6 |
15N chemical shifts | 17 | 4 | 23.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 97 | 88 | 90.7 |
1H chemical shifts | 97 | 81 | 83.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 28 | 14 | 50.0 |
1H chemical shifts | 28 | 14 | 50.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHMGTLEAQTQGPGSMDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKTPLPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEV ||||||||||||||||| ||| ||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||| ..........TLEAQTQGPGSMDVTIY..PVC.TSRKVLGMIREAGIEPHVIEY..TPLPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEV -------110-------120-------130------ LIDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL |||||||||||||||||||||||||||||||||||| LIDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHMGTLEAQTQGPGSMDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKTPLPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEV |||| | ||| ||||||||||| | | |||||||||||| | || || | |||| .......................VTIY...V.GTS.KVLGMIREAGI..H.I.......PRDMLVELLRQM...........E.RY..LG..D...SDEV -------110-------120-------130------ LIDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL |||||| || || ||||| | | | || ||| || LIDAMI.NP.LM..PVVVT..G.R.C.PA.TVQ.LL
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHMGTLEAQTQGPGSMDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKTPLPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEV |||||||||||||||||| |||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||| MAHHHHHHMGTLEAQTQG.GSMDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKT.LPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEV -------110-------120-------130------ LIDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL |||||||||||||||||||||||||||||||||||| LIDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL