BMRBj - BMREntryMaster

Found 1 Document (0.751 seconds)

BMRB: 25229

2MUQ

Solution Structure of the Human FAAP20 UBZ

Authors

Wojtaszek, J.L., Wang, S., Zhou, P.

Assembly

Human FAAP20 UBZ

Entity

1. UBZ (polymer, Thiol state: all other bound), 44 monomers, 4848.449 Da Detail

SHMGAAALRS CPMCQKEFAP RLTQLDVDSH LAQCLAESTE DVTW

2. Human FAAP20 UBZ, entity ZN (non-polymer), 65.409 Da

Total weight

4913.8584 Da

Max. entity weight

4848.449 Da

Entity Connection

metal coordination 4 Detail

ID	Type	Value order	Atom ID 1	Atom ID 2
1	metal coordination	sing	1:CYS11:SG	2:ZN1:ZN
2	metal coordination	sing	1:CYS14:SG	2:ZN1:ZN
3	metal coordination	sing	1:CYS34:SG	2:ZN1:ZN
4	metal coordination	sing	1:HIS30:NE2	2:ZN1:ZN

Source organism

Homo sapiens

Exptl. method

solution NMR

Refine. method

torsion angle dynamics

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 97.7 %, Completeness: 86.7 %, Completeness (bb): 80.4 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	86.7 % (417 of 481)	94.3 % (233 of 247)	76.6 % (144 of 188)	87.0 % (40 of 46)
Backbone	80.4 % (209 of 260)	95.4 % (83 of 87)	66.4 % (87 of 131)	92.9 % (39 of 42)
Sidechain	94.7 % (250 of 264)	93.8 % (150 of 160)	99.0 % (99 of 100)	25.0 % (1 of 4)
Aromatic	100.0 % (30 of 30)	100.0 % (15 of 15)	100.0 % (14 of 14)	100.0 % (1 of 1)
Methyl	100.0 % (46 of 46)	100.0 % (23 of 23)	100.0 % (23 of 23)

1. UBZ

SHMGAAALRS CPMCQKEFAP RLTQLDVDSH LAQCLAESTE DVTW

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
1	Human FAAP20 UBZ	[U-100% 15N]	1.5 mM
2	sodium phosphate	natural abundance	25 mM
3	potassium chloride	natural abundance	100 mM
4	DTT	natural abundance	10 mM
5	sodium azide	natural abundance	0.05 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
6	Human FAAP20 UBZ	[U-100% 13C; U-100% 15N]	1.5 mM
7	sodium phosphate	natural abundance	25 mM
8	potassium chloride	natural abundance	100 mM
9	DTT	natural abundance	10 mM
10	sodium azide	natural abundance	0.05 %

Sample #3

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
11	Human FAAP20 UBZ	[U-100% 13C; U-100% 15N]	1.5 mM
12	sodium phosphate	natural abundance	25 mM
13	potassium chloride	natural abundance	100 mM
14	DTT	natural abundance	10 mM
15	sodium azide	natural abundance	0.05 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.15 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.15 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.03 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 10 models in PDB: 2MUQ, Strand ID: A Detail

Release date

2016-09-22

Citation

Ubiquitin recognition by FAAP20 expands the complex interface beyond the canonical UBZ domain
Wojtaszek, J.L., Wang, S., Kim, H., Wu, Q.L., D'Andrea, A.D., Zhou, P.
Nucleic Acids Res. (2014), 42, 13997-14005, PubMed 25414354 , DOI 10.1093/nar/gku1153 , Abstract

Entries sharing articles BMRB: 1 entries Detail

BMRB: 25230 released on 2016-09-21
Title Solution Structure of the Human FAAP20 UBZ-Ubiquitin Complex

Related entities 1. UBZ, : 1 : 1 : 2 : 10 entities Detail

Interaction partners 1. UBZ, : 9 interactors Detail

More details for 9 interactors identified by 4 citations

Experiments performed 13 experiments Detail

1 2D 1H-15N HSQC

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
1	Human FAAP20 UBZ	[U-100% 15N]	1.5 mM
2	sodium phosphate	natural abundance	25 mM
3	potassium chloride	natural abundance	100 mM
4	DTT	natural abundance	10 mM
5	sodium azide	natural abundance	0.05 %

2 3D sparse-sampled HNCO

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
6	Human FAAP20 UBZ	[U-100% 13C; U-100% 15N]	1.5 mM
7	sodium phosphate	natural abundance	25 mM
8	potassium chloride	natural abundance	100 mM
9	DTT	natural abundance	10 mM
10	sodium azide	natural abundance	0.05 %

3 3D sparse-sampled HNCA

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
6	Human FAAP20 UBZ	[U-100% 13C; U-100% 15N]	1.5 mM
7	sodium phosphate	natural abundance	25 mM
8	potassium chloride	natural abundance	100 mM
9	DTT	natural abundance	10 mM
10	sodium azide	natural abundance	0.05 %

4 3D sparse-sampled HNCOCA

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
6	Human FAAP20 UBZ	[U-100% 13C; U-100% 15N]	1.5 mM
7	sodium phosphate	natural abundance	25 mM
8	potassium chloride	natural abundance	100 mM
9	DTT	natural abundance	10 mM
10	sodium azide	natural abundance	0.05 %

5 3D sparse-sampled HNCACB

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
6	Human FAAP20 UBZ	[U-100% 13C; U-100% 15N]	1.5 mM
7	sodium phosphate	natural abundance	25 mM
8	potassium chloride	natural abundance	100 mM
9	DTT	natural abundance	10 mM
10	sodium azide	natural abundance	0.05 %

6 3D sparse-sampled HNCOCACB

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
6	Human FAAP20 UBZ	[U-100% 13C; U-100% 15N]	1.5 mM
7	sodium phosphate	natural abundance	25 mM
8	potassium chloride	natural abundance	100 mM
9	DTT	natural abundance	10 mM
10	sodium azide	natural abundance	0.05 %

7 3D sparse-sampled HACANH

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
6	Human FAAP20 UBZ	[U-100% 13C; U-100% 15N]	1.5 mM
7	sodium phosphate	natural abundance	25 mM
8	potassium chloride	natural abundance	100 mM
9	DTT	natural abundance	10 mM
10	sodium azide	natural abundance	0.05 %

8 3D sparse-sampled HACACONH

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
6	Human FAAP20 UBZ	[U-100% 13C; U-100% 15N]	1.5 mM
7	sodium phosphate	natural abundance	25 mM
8	potassium chloride	natural abundance	100 mM
9	DTT	natural abundance	10 mM
10	sodium azide	natural abundance	0.05 %

9 4D sparse-sampled HCccoNH TOCSY

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
6	Human FAAP20 UBZ	[U-100% 13C; U-100% 15N]	1.5 mM
7	sodium phosphate	natural abundance	25 mM
8	potassium chloride	natural abundance	100 mM
9	DTT	natural abundance	10 mM
10	sodium azide	natural abundance	0.05 %

10 3D 1H-15N NOESY

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
1	Human FAAP20 UBZ	[U-100% 15N]	1.5 mM
2	sodium phosphate	natural abundance	25 mM
3	potassium chloride	natural abundance	100 mM
4	DTT	natural abundance	10 mM
5	sodium azide	natural abundance	0.05 %

11 4D sparse-sampled HCCH TOCSY

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
11	Human FAAP20 UBZ	[U-100% 13C; U-100% 15N]	1.5 mM
12	sodium phosphate	natural abundance	25 mM
13	potassium chloride	natural abundance	100 mM
14	DTT	natural abundance	10 mM
15	sodium azide	natural abundance	0.05 %

12 4D sparse-sampled CHCH NOESY

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
11	Human FAAP20 UBZ	[U-100% 13C; U-100% 15N]	1.5 mM
12	sodium phosphate	natural abundance	25 mM
13	potassium chloride	natural abundance	100 mM
14	DTT	natural abundance	10 mM
15	sodium azide	natural abundance	0.05 %

13 4D sparse-sampled CHNH NOESY

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
6	Human FAAP20 UBZ	[U-100% 13C; U-100% 15N]	1.5 mM
7	sodium phosphate	natural abundance	25 mM
8	potassium chloride	natural abundance	100 mM
9	DTT	natural abundance	10 mM
10	sodium azide	natural abundance	0.05 %

NMR combined restraints 5 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_25229_2muq.nef
Input source #2: Coordindates	2muq.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	True (see coodinates for details)
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Ptnr_site_1	Ptnr_site_2	Redox_state_prediction_1	Redox_state_prediction_2	Distance (Å)
1:30:HIS:NE2	2:1:ZN:ZN	unknown	unknown	n/a
1:34:CYS:SG	2:1:ZN:ZN	unknown	unknown	n/a
1:11:CYS:SG	2:1:ZN:ZN	unknown	unknown	n/a
1:14:CYS:SG	2:1:ZN:ZN	unknown	unknown	n/a

Non-standard residues

Chain_ID	Seq_ID	Comp_ID	Chem_comp_name	Experimental evidences
B	1	ZN	ZINC ION	None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40----
SHMGAAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW
||||||||||||||||||||||||||||||||||||||||||||
SHMGAAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	44	0	0	100.0

Content subtype: combined_25229_2muq.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Covalent bonds	assembly	OK	4		No information
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	415		97.7 (chain: A, length: 44)
1	Distance restraints	DYANA/DIANA_distance_constraints_2	OK	1019 (1)	noe	90.9 (chain: A, length: 44)
2	Distance restraints	DYANA/DIANA_distance_constraints_3	OK	28 (1)	hbond	43.2 (chain: A, length: 44)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_4	OK	44 (44)	.	63.6 (chain: A, length: 44)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 44, Sequence coverage: 97.7%
- Total number of assignments
  - ¹H chemical shifts: 233
  - ¹³C chemical shifts: 142
  - ¹⁵N chemical shifts: 40
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	247	233	94.3
¹³C chemical shifts	188	142	75.5
¹⁵N chemical shifts	48	40	83.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	87	83	95.4
¹³C chemical shifts	88	43	48.9
¹⁵N chemical shifts	42	39	92.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	160	150	93.8
¹³C chemical shifts	100	99	99.0
¹⁵N chemical shifts	6	1	16.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	25	25	100.0
¹³C chemical shifts	25	25	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	15	15	100.0
¹³C chemical shifts	14	14	100.0
¹⁵N chemical shifts	1	1	100.0

Covalent bonds

Saveframe: assembly
- Status: OK

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 44, Sequence coverage: 90.9%
- Total number of restraints: 1018
- Weight of restraints: 1.0 (1018)
- Potential type of restraints: upper-bound-parabolic (1018)
- Range of distance target values: 2.51, 7.0 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
  - Chain_ID: B
    None
- Distance restraints on contact map
- Saveframe: DYANA/DIANA_distance_constraints_3
  - Status: OK
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 44, Sequence coverage: 43.2%
  - Total number of restraints: 28
  - Weight of restraints: 1.0 (28)
  - Potential type of restraints: upper-bound-parabolic (28)
  - Range of distance target values: 2.5, 3.5 (Å)
  - Histogram of distance target values
  - Distance restraints per residue
    - Chain_ID: A
    - Chain_ID: B
      None
  - Distance restraints on contact map

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_4
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 44, Sequence coverage: 63.6%
- Total number of restraints: 44
- Total number of restraints per polymer type: 44
- Weight of restraints: 1.0 (44)
- Potential type of restraints: square-well-parabolic (44)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords FAAP20, Fanconi Anemia, UBZ, ubiquitin-binding, zinc finger

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.751 seconds)

BMRB: 25229

Sample #1

Sample #2

Sample #3

Chemical shift reference

Chemical shift reference

Chemical shift reference

Entries sharing articles BMRB: 1 entries Detail

Related entities 1. UBZ, : 1 : 1 : 2 : 10 entities Detail

Interaction partners 1. UBZ, : 9 interactors Detail

Experiments performed 13 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 5 contents Detail