Structural insight into an essential assembly factor network on the pre-ribosome
YERFIRPMGL RYKKANVTHP TLNVTVQLPI LSVKKNPSNP LYTQLGVLTK GTIIEVNVSD LGIVTASGKI AWGRYAQITN NPENDGCVNA VLLVYERFIR PMGLRYKKAN VTHPTLNVTV QLPILSVKKN PSNPLYTQLG VLTKGTIIEV NVSDLGIVTA SGKIAWGRYA QITNNPENDG CVNAVLLV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 49.5 % (1089 of 2198) | 49.2 % (559 of 1136) | 49.5 % (426 of 860) | 51.5 % (104 of 202) |
Backbone | 56.1 % (619 of 1104) | 57.4 % (217 of 378) | 54.5 % (300 of 550) | 58.0 % (102 of 176) |
Sidechain | 44.6 % (566 of 1268) | 45.1 % (342 of 758) | 45.9 % (222 of 484) | 7.7 % (2 of 26) |
Aromatic | 21.6 % (25 of 116) | 24.1 % (14 of 58) | 19.6 % (11 of 56) | 0.0 % (0 of 2) |
Methyl | 48.9 % (135 of 276) | 48.6 % (67 of 138) | 49.3 % (68 of 138) |
1. entity
YERFIRPMGL RYKKANVTHP TLNVTVQLPI LSVKKNPSNP LYTQLGVLTK GTIIEVNVSD LGIVTASGKI AWGRYAQITN NPENDGCVNA VLLVYERFIR PMGLRYKKAN VTHPTLNVTV QLPILSVKKN PSNPLYTQLG VLTKGTIIEV NVSDLGIVTA SGKIAWGRYA QITNNPENDG CVNAVLLVSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 280 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | TRIS | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | sodium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 1 uM | |
6 | TCEP | natural abundance | 2 mM | |
7 | entity | [U-99% 13C; U-99% 15N] | 450 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 280 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | TRIS | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | sodium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 1 uM | |
6 | TCEP | natural abundance | 2 mM | |
7 | entity | [U-99% 13C; U-99% 15N] | 450 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 280 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | TRIS | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | sodium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 1 uM | |
6 | TCEP | natural abundance | 2 mM | |
7 | entity | [U-99% 13C; U-99% 15N] | 450 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 280 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | TRIS | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | sodium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 1 uM | |
6 | TCEP | natural abundance | 2 mM | |
7 | entity | [U-99% 13C; U-99% 15N] | 450 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 280 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | TRIS | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | sodium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 1 uM | |
6 | TCEP | natural abundance | 2 mM | |
7 | entity | [U-99% 13C; U-99% 15N] | 450 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 280 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | TRIS | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | sodium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 1 uM | |
6 | TCEP | natural abundance | 2 mM | |
7 | entity | [U-99% 13C; U-99% 15N] | 450 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 280 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | TRIS | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | sodium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 1 uM | |
6 | TCEP | natural abundance | 2 mM | |
7 | entity | [U-99% 13C; U-99% 15N] | 450 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 280 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | TRIS | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | sodium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 1 uM | |
6 | TCEP | natural abundance | 2 mM | |
7 | entity | [U-99% 13C; U-99% 15N] | 450 mM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 280 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | TRIS | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | sodium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 1 uM | |
6 | TCEP | natural abundance | 2 mM | |
7 | entity | [U-99% 13C; U-99% 15N] | 450 mM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 280 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | TRIS | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | sodium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 1 uM | |
6 | TCEP | natural abundance | 2 mM | |
7 | entity | [U-99% 13C; U-99% 15N] | 450 mM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 280 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | TRIS | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | sodium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 1 uM | |
6 | TCEP | natural abundance | 2 mM | |
7 | entity | [U-99% 13C; U-99% 15N] | 450 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 280 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D2O | natural abundance | 10 % | |
2 | TRIS | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | sodium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 1 uM | |
6 | TCEP | natural abundance | 2 mM | |
7 | entity | [U-99% 13C; U-99% 15N] | 450 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25265_2mvf.nef |
Input source #2: Coordindates | 2mvf.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--170-----180-------190-------200-------210-------220-------230-------240-------250-------260- YERFIRPMGLRYKKANVTHPTLNVTVQLPILSVKKNPSNPLYTQLGVLTKGTIIEVNVSDLGIVTASGKIAWGRYAQITNNPENDGCVNAVLLV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YERFIRPMGLRYKKANVTHPTLNVTVQLPILSVKKNPSNPLYTQLGVLTKGTIIEVNVSDLGIVTASGKIAWGRYAQITNNPENDGCVNAVLLV --------10--------20--------30--------40--------50--------60--------70--------80--------90----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 94 | 0 | 0 | 100.0 |
Content subtype: combined_25265_2mvf.nef
Assigned chemical shifts
--170-----180-------190-------200-------210-------220-------230-------240-------250-------260- YERFIRPMGLRYKKANVTHPTLNVTVQLPILSVKKNPSNPLYTQLGVLTKGTIIEVNVSDLGIVTASGKIAWGRYAQITNNPENDGCVNAVLLV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YERFIRPMGLRYKKANVTHPTLNVTVQLPILSVKKNPSNPLYTQLGVLTKGTIIEVNVSDLGIVTASGKIAWGRYAQITNNPENDGCVNAVLLV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 568 | 501 | 88.2 |
13C chemical shifts | 430 | 365 | 84.9 |
15N chemical shifts | 105 | 86 | 81.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 189 | 187 | 98.9 |
13C chemical shifts | 188 | 175 | 93.1 |
15N chemical shifts | 88 | 86 | 97.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 379 | 314 | 82.8 |
13C chemical shifts | 242 | 190 | 78.5 |
15N chemical shifts | 17 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 67 | 95.7 |
13C chemical shifts | 70 | 60 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 29 | 7 | 24.1 |
13C chemical shifts | 28 | 2 | 7.1 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--170-----180-------190-------200-------210-------220-------230-------240-------250-------260- YERFIRPMGLRYKKANVTHPTLNVTVQLPILSVKKNPSNPLYTQLGVLTKGTIIEVNVSDLGIVTASGKIAWGRYAQITNNPENDGCVNAVLLV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||| YERFIRPMGLRYKKANVTHPTLNVTVQLPILSVKKNPSNPLYTQLGVLTKGTIIEVNVSDLGIVTASGKIAW.RYAQITNNPENDGCVNAVLLV
Dihedral angle restraints
--170-----180-------190-------200-------210-------220-------230-------240-------250-------260- YERFIRPMGLRYKKANVTHPTLNVTVQLPILSVKKNPSNPLYTQLGVLTKGTIIEVNVSDLGIVTASGKIAWGRYAQITNNPENDGCVNAVLLV |||||||||||||||||||||||||||| ||||||||||||||| ||||||||||||||||||||||||| .........LRYKKANVTHPTLNVTVQLPILSVKKNP.........VLTKGTIIEVNVSDL........IAWGRYAQITNNPENDGCVNAVLLV