NMR structure of the protein NP_809137.1 from Bacteroides thetaiotaomicron
GCELSDPDGL ADPMKWSKVP SGLKNGELKV EAEGGSSLFA CKNYKSFWIS SVKEEGKFKE NTSYKEFDGG WYLVKIEDNE LKVIINRNET NASRSFTVCV EAGNAFDEFK FVQDAAKQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.3 % (1205 of 1381) | 93.2 % (672 of 721) | 76.9 % (409 of 532) | 96.9 % (124 of 128) |
Backbone | 83.0 % (583 of 702) | 93.8 % (228 of 243) | 70.9 % (244 of 344) | 96.5 % (111 of 115) |
Sidechain | 92.4 % (727 of 787) | 92.9 % (444 of 478) | 91.2 % (270 of 296) | 100.0 % (13 of 13) |
Aromatic | 87.9 % (123 of 140) | 91.4 % (64 of 70) | 83.6 % (56 of 67) | 100.0 % (3 of 3) |
Methyl | 93.9 % (92 of 98) | 93.9 % (46 of 49) | 93.9 % (46 of 49) |
1. entity
GCELSDPDGL ADPMKWSKVP SGLKNGELKV EAEGGSSLFA CKNYKSFWIS SVKEEGKFKE NTSYKEFDGG WYLVKIEDNE LKVIINRNET NASRSFTVCV EAGNAFDEFK FVQDAAKQSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | [U-99% 2H] | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | [U-99% 2H] | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | [U-99% 2H] | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | [U-99% 2H] | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | [U-99% 2H] | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | [U-99% 2H] | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | [U-99% 2H] | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | [U-99% 2H] | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_25294_2mw1.nef |
Input source #2: Coordindates | 2mw1.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GCELSDPDGLADPMKWSKVPSGLKNGELKVEAEGGSSLFACKNYKSFWISSVKEEGKFKENTSYKEFDGGWYLVKIEDNELKVIINRNETNASRSFTVCV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GCELSDPDGLADPMKWSKVPSGLKNGELKVEAEGGSSLFACKNYKSFWISSVKEEGKFKENTSYKEFDGGWYLVKIEDNELKVIINRNETNASRSFTVCV -------110-------- EAGNAFDEFKFVQDAAKQ |||||||||||||||||| EAGNAFDEFKFVQDAAKQ
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 118 | 0 | 0 | 100.0 |
Content subtype: combined_25294_2mw1.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GCELSDPDGLADPMKWSKVPSGLKNGELKVEAEGGSSLFACKNYKSFWISSVKEEGKFKENTSYKEFDGGWYLVKIEDNELKVIINRNETNASRSFTVCV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....SDPDGLADPMKWSKVPSGLKNGELKVEAEGGSSLFACKNYKSFWISSVKEEGKFKENTSYKEFDGGWYLVKIEDNELKVIINRNETNASRSFTVCV -------110-------- EAGNAFDEFKFVQDAAKQ |||||||||||||||||| EAGNAFDEFKFVQDAAKQ
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 721 | 668 | 92.6 |
13C chemical shifts | 532 | 384 | 72.2 |
15N chemical shifts | 130 | 124 | 95.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 243 | 225 | 92.6 |
13C chemical shifts | 236 | 114 | 48.3 |
15N chemical shifts | 115 | 111 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 478 | 443 | 92.7 |
13C chemical shifts | 296 | 270 | 91.2 |
15N chemical shifts | 15 | 13 | 86.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 47 | 94.0 |
13C chemical shifts | 50 | 47 | 94.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 63 | 90.0 |
13C chemical shifts | 67 | 56 | 83.6 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GCELSDPDGLADPMKWSKVPSGLKNGELKVEAEGGSSLFACKNYKSFWISSVKEEGKFKENTSYKEFDGGWYLVKIEDNELKVIINRNETNASRSFTVCV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....SDPDGLADPMKWSKVPSGLKNGELKVEAEGGSSLFACKNYKSFWISSVKEEGKFKENTSYKEFDGGWYLVKIEDNELKVIINRNETNASRSFTVCV -------110-------- EAGNAFDEFKFVQDAAKQ |||||||||||||||||| EAGNAFDEFKFVQDAAKQ