BMRBj - BMREntryMaster

Found 1 Document (0.745 seconds)

BMRB: 25296

2MW2

Hha-H-NS46 charge zipper complex

Authors

Cordeiro, T.N., Garcia, J., Bernado, P., Millet, O., Pons, M.

Assembly

Hha-H-NS46 charge zipper complex

Entity

1. Hha-H-NS46 charge zipper complex, entity 1 (polymer), 69 monomers, 8312.513 Da Detail

EKLTKTDYLM RLRRCQTIDT LERVIEKNKY ELSDNELAVF YSAADHRLAE LTMNKLYDKI PSSVWKFIR

2. Hha-H-NS46 charge zipper complex, entity 2 (polymer), 46 monomers, 5328.981 × 2 Da Detail

SEALKILNNI RTLRAQAREC TLETLEEMLE KLEVVVNERR EEESAA

Total weight

18970.475 Da

Max. entity weight

8312.513 Da

Source organism

Escherichia coli

Exptl. method

solution NMR

Refine. method

Rigid-body/torsion angle simulated annealing, Cartesian Molecular dynamics

Data set

assigned_chemical_shifts

Chem. Shift Complete1

Sequence coverage: 59.1 %, Completeness: 18.6 %, Completeness (bb): 39.7 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹⁵N
All	18.6 % (159 of 855)	12.4 % (91 of 732)	55.3 % (68 of 123)
Backbone	39.7 % (136 of 343)	30.6 % (70 of 229)	57.9 % (66 of 114)
Sidechain	4.5 % (23 of 512)	4.2 % (21 of 503)	22.2 % (2 of 9)
Aromatic	20.0 % (7 of 35)	17.6 % (6 of 34)	100.0 % (1 of 1)
Methyl	2.7 % (2 of 73)	2.7 % (2 of 73)

1. entity 1

EKLTKTDYLM RLRRCQTIDT LERVIEKNKY ELSDNELAVF YSAADHRLAE LTMNKLYDKI PSSVWKFIR

2. entity 2

SEALKILNNI RTLRAQAREC TLETLEEMLE KLEVVVNERR EEESAA

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details MTSL-tag placed at position D37C.

#	Name	Isotope labeling	Concentration
1	entity_1	natural abundance	0.015 ~ 0.03 mM
2	entity_2	[U-100% 15N]	0.10 mM
3	HEPES	natural abundance	20 mM
4	sodium chloride	natural abundance	150 mM
5	sodium azide	natural abundance	0.01 w/v
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details MTSL-tag placed at position S66C.

#	Name	Isotope labeling	Concentration
8	entity_1	natural abundance	0.015 ~ 0.03 mM
9	entity_2	[U-100% 15N]	0.10 mM
10	HEPES	natural abundance	20 mM
11	sodium chloride	natural abundance	150 mM
12	sodium azide	natural abundance	0.01 w/v
13	H2O	natural abundance	90 %
14	D2O	natural abundance	10 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details C18I Native C18 was mutated to isoleucine.

#	Name	Isotope labeling	Concentration
15	entity_1	[U-100% 15N]	0.9 mM
16	sodium chloride	natural abundance	150 mM
17	sodium azide	natural abundance	0.01 w/v
18	sodium phosphate	natural abundance	20 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

Sample #4

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details C21S Native C121 was mutated to serine.

#	Name	Isotope labeling	Concentration
21	entity_2	[U-100% 15N]	0.9 mM
22	sodium chloride	natural abundance	150 mM
23	sodium azide	natural abundance	0.01 w/v
24	sodium phosphate	natural abundance	20 mM
25	H2O	natural abundance	90 %
26	D2O	natural abundance	10 %

Chem. Shift Complete2

Sequence coverage: 42.6 %, Completeness: 16.7 %, Completeness (bb): 34.5 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹⁵N
All	16.7 % (285 of 1710)	11.2 % (164 of 1464)	49.2 % (121 of 246)
Backbone	34.5 % (237 of 686)	26.6 % (122 of 458)	50.4 % (115 of 228)
Sidechain	4.7 % (48 of 1024)	4.2 % (42 of 1006)	33.3 % (6 of 18)
Aromatic	10.0 % (7 of 70)	8.8 % (6 of 68)	50.0 % (1 of 2)
Methyl	4.1 % (6 of 146)	4.1 % (6 of 146)

1. entity 1

EKLTKTDYLM RLRRCQTIDT LERVIEKNKY ELSDNELAVF YSAADHRLAE LTMNKLYDKI PSSVWKFIR

2. entity 2

SEALKILNNI RTLRAQAREC TLETLEEMLE KLEVVVNERR EEESAA

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details MTSL-tag placed at position D37C.

#	Name	Isotope labeling	Concentration
1	entity_1	natural abundance	0.015 ~ 0.03 mM
2	entity_2	[U-100% 15N]	0.10 mM
3	HEPES	natural abundance	20 mM
4	sodium chloride	natural abundance	150 mM
5	sodium azide	natural abundance	0.01 w/v
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details MTSL-tag placed at position S66C.

#	Name	Isotope labeling	Concentration
8	entity_1	natural abundance	0.015 ~ 0.03 mM
9	entity_2	[U-100% 15N]	0.10 mM
10	HEPES	natural abundance	20 mM
11	sodium chloride	natural abundance	150 mM
12	sodium azide	natural abundance	0.01 w/v
13	H2O	natural abundance	90 %
14	D2O	natural abundance	10 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details C18I Native C18 was mutated to isoleucine.

#	Name	Isotope labeling	Concentration
15	entity_1	[U-100% 15N]	0.9 mM
16	sodium chloride	natural abundance	150 mM
17	sodium azide	natural abundance	0.01 w/v
18	sodium phosphate	natural abundance	20 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

Sample #4

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details C21S Native C121 was mutated to serine.

#	Name	Isotope labeling	Concentration
21	entity_2	[U-100% 15N]	0.9 mM
22	sodium chloride	natural abundance	150 mM
23	sodium azide	natural abundance	0.01 w/v
24	sodium phosphate	natural abundance	20 mM
25	H2O	natural abundance	90 %
26	D2O	natural abundance	10 %

Protein Blocks Logo

Calculated from 10 models in PDB: 2MW2, Strand ID: A, B, C Detail

Release date

2015-07-26

Citation

A Three-protein Charge Zipper Stabilizes a Complex Modulating Bacterial Gene Silencing
Cordeiro, T.N., Garcia, J., Bernado, P., Millet, O., Pons, M.
J. Biol. Chem. (2015), 290, 21200-21212, PubMed 26085102 , DOI 10.1074/jbc.M114.630400 , Abstract

Related entities 1. Hha-H-NS46 charge zipper complex, entity 1, : 1 : 4 : 8 entities Detail

Related entities 2. Hha-H-NS46 charge zipper complex, entity 2, : 1 : 2 : 3 : 4 entities Detail

Experiments performed 8 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details MTSL-tag placed at position D37C.

#	Name	Isotope labeling	Concentration
1	entity_1	natural abundance	0.015 ~ 0.03 mM
2	entity_2	[U-100% 15N]	0.10 mM
3	HEPES	natural abundance	20 mM
4	sodium chloride	natural abundance	150 mM
5	sodium azide	natural abundance	0.01 w/v
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

2 2D 1H-15N HSQC

Instrument

Bruker Avance III - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details MTSL-tag placed at position S66C.

#	Name	Isotope labeling	Concentration
8	entity_1	natural abundance	0.015 ~ 0.03 mM
9	entity_2	[U-100% 15N]	0.10 mM
10	HEPES	natural abundance	20 mM
11	sodium chloride	natural abundance	150 mM
12	sodium azide	natural abundance	0.01 w/v
13	H2O	natural abundance	90 %
14	D2O	natural abundance	10 %

3 2D 1H-15N HSQC

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details C18I Native C18 was mutated to isoleucine.

#	Name	Isotope labeling	Concentration
15	entity_1	[U-100% 15N]	0.9 mM
16	sodium chloride	natural abundance	150 mM
17	sodium azide	natural abundance	0.01 w/v
18	sodium phosphate	natural abundance	20 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

4 3D 1H-15N NOESY

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details C18I Native C18 was mutated to isoleucine.

#	Name	Isotope labeling	Concentration
15	entity_1	[U-100% 15N]	0.9 mM
16	sodium chloride	natural abundance	150 mM
17	sodium azide	natural abundance	0.01 w/v
18	sodium phosphate	natural abundance	20 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

5 3D 1H-15N TOCSY

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details C18I Native C18 was mutated to isoleucine.

#	Name	Isotope labeling	Concentration
15	entity_1	[U-100% 15N]	0.9 mM
16	sodium chloride	natural abundance	150 mM
17	sodium azide	natural abundance	0.01 w/v
18	sodium phosphate	natural abundance	20 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

6 2D 1H-15N HSQC

Instrument

Bruker Avance III - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details C21S Native C121 was mutated to serine.

#	Name	Isotope labeling	Concentration
21	entity_2	[U-100% 15N]	0.9 mM
22	sodium chloride	natural abundance	150 mM
23	sodium azide	natural abundance	0.01 w/v
24	sodium phosphate	natural abundance	20 mM
25	H2O	natural abundance	90 %
26	D2O	natural abundance	10 %

7 3D 1H-15N NOESY

Instrument

Bruker Avance III - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details C21S Native C121 was mutated to serine.

#	Name	Isotope labeling	Concentration
21	entity_2	[U-100% 15N]	0.9 mM
22	sodium chloride	natural abundance	150 mM
23	sodium azide	natural abundance	0.01 w/v
24	sodium phosphate	natural abundance	20 mM
25	H2O	natural abundance	90 %
26	D2O	natural abundance	10 %

8 3D 1H-15N TOCSY

Instrument

Bruker Avance III - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 7.0, Details C21S Native C121 was mutated to serine.

#	Name	Isotope labeling	Concentration
21	entity_2	[U-100% 15N]	0.9 mM
22	sodium chloride	natural abundance	150 mM
23	sodium azide	natural abundance	0.01 w/v
24	sodium phosphate	natural abundance	20 mM
25	H2O	natural abundance	90 %
26	D2O	natural abundance	10 %

NMR combined restraints 3 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts	combined_25296_2mw2.nef
Input source #2: Coordindates	2mw2.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Error

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70--
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

Entity_assembly_ID (NMR): B vs Auth_asym_ID (model): B

--------10--------20--------30--------40-------
MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAA
|||||||||||||||||||||||||||||||||||||||||||||||
MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAA

Entity_assembly_ID (NMR): C vs Auth_asym_ID (model): C

--------10--------20--------30--------40-------
MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAA
|||||||||||||||||||||||||||||||||||||||||||||||
MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAA

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Sequence coverage (%)
A	A	72	100.0
B	B	47	100.0
C	C	47	100.0

Content subtype: combined_25296_2mw2.nef

#	Content subtype	Saveframe	Status	# of rows	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	OK	133		88.9 (chain: A, length: 72)
2	Assigned chemical shifts	assigned_chem_shift_list_2	OK	102		95.7 (chain: B, length: 47)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: OK
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 72, Sequence coverage: 88.9%
- Total number of assignments
  - ¹H chemical shifts: 67
  - ¹⁵N chemical shifts: 66
- Completeness of assignments
  - Entity_assemble_ID: A
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A
Saveframe: assigned_chem_shift_list_2
- Status: OK
- Sequence coverage of experimental data
  - Entity_assembly_ID: B, Chain length: 47, Sequence coverage: 95.7%
- Total number of assignments
  - ¹H chemical shifts: 53
  - ¹⁵N chemical shifts: 49
- Completeness of assignments
  - Entity_assemble_ID: B
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: B

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	469	67	14.3
¹⁵N chemical shifts	81	66	81.5

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	142	64	45.1
¹⁵N chemical shifts	70	64	91.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	327	3	0.9
¹⁵N chemical shifts	11	2	18.2

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	44	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	34	1	2.9
¹⁵N chemical shifts	1	1	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	288	53	18.4
¹⁵N chemical shifts	56	49	87.5

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	94	45	47.9
¹⁵N chemical shifts	47	45	95.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	194	8	4.1
¹⁵N chemical shifts	9	4	44.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	34	0	0.0

Keywords Charge-zipper complex, Electrostatic-driven function, Nucleoid-associated Proteins, Salt-dependent dynamics

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.745 seconds)

BMRB: 25296

Sample #1

Sample #2

Sample #3

Sample #4

Sample #1

Sample #2

Sample #3

Sample #4

Related entities 1. Hha-H-NS46 charge zipper complex, entity 1, : 1 : 4 : 8 entities Detail

Related entities 2. Hha-H-NS46 charge zipper complex, entity 2, : 1 : 2 : 3 : 4 entities Detail

Experiments performed 8 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 3 contents Detail