Solution structure of PsbQ from spinacia oleracea
EARPIVVGPP PPLSGGLPGT ENSDQARDGT LPYTKDRFYL QPLPPTEAAQ RAKVSASEIL NVKQFIDRKA WPSLQNDLRL RASYLRYDLK TVISAKPKDE KKSLQELTSK LFSSIDNLDH AAKIKSPTEA EKYYGQTVSN INEVLAKLG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.3 % (1566 of 1753) | 85.4 % (788 of 923) | 94.1 % (640 of 680) | 92.0 % (138 of 150) |
Backbone | 96.9 % (841 of 868) | 95.5 % (279 of 292) | 97.7 % (430 of 440) | 97.1 % (132 of 136) |
Sidechain | 84.1 % (864 of 1027) | 80.7 % (509 of 631) | 91.4 % (349 of 382) | 42.9 % (6 of 14) |
Aromatic | 72.3 % (68 of 94) | 74.5 % (35 of 47) | 71.7 % (33 of 46) | 0.0 % (0 of 1) |
Methyl | 96.4 % (160 of 166) | 95.2 % (79 of 83) | 97.6 % (81 of 83) |
1. PsbQ
EARPIVVGPP PPLSGGLPGT ENSDQARDGT LPYTKDRFYL QPLPPTEAAQ RAKVSASEIL NVKQFIDRKA WPSLQNDLRL RASYLRYDLK TVISAKPKDE KKSLQELTSK LFSSIDNLDH AAKIKSPTEA EKYYGQTVSN INEVLAKLGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 50 uM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium azide | natural abundance | 50 uM | |
10 | EDTA | natural abundance | 1 mM | |
11 | D2O | [U-100% 2H] | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 50 uM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 50 uM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 50 uM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 50 uM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 50 uM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 50 uM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 50 uM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 50 uM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 50 uM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 50 uM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 50 uM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 50 uM | |
4 | EDTA | natural abundance | 1 mM | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium azide | natural abundance | 50 uM | |
10 | EDTA | natural abundance | 1 mM | |
11 | D2O | [U-100% 2H] | 100 % |
Bruker AVIII - 700 MHz TCI cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PsbQ | [U-13C; U-15N] | 0.8 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium azide | natural abundance | 50 uM | |
10 | EDTA | natural abundance | 1 mM | |
11 | D2O | [U-100% 2H] | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25350_2mwq.nef |
Input source #2: Coordindates | 2mwq.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 EARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| EARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDE -------110-------120-------130-------140--------- KKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG ||||||||||||||||||||||||||||||||||||||||||||||||| KKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 149 | 0 | 0 | 100.0 |
Content subtype: combined_25350_2mwq.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 EARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||| EARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWP.LQNDLRLRASYLRYDLKTVISAKPKDE -------110-------120-------130-------140--------- KKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG ||||||||||||||||||||||||||||||||||||||||||||||||| KKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
4 | PRO | N | 137.044 |
9 | PRO | N | 135.78 |
10 | PRO | N | 136.956 |
11 | PRO | N | 136.418 |
12 | PRO | N | 135.006 |
18 | PRO | N | 136.735 |
32 | PRO | N | 135.635 |
42 | PRO | N | 138.337 |
44 | PRO | N | 133.601 |
45 | PRO | N | 133.441 |
72 | PRO | N | 136.568 |
97 | PRO | N | 132.979 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 923 | 770 | 83.4 |
13C chemical shifts | 680 | 638 | 93.8 |
15N chemical shifts | 158 | 136 | 86.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 292 | 282 | 96.6 |
13C chemical shifts | 298 | 293 | 98.3 |
15N chemical shifts | 136 | 131 | 96.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 631 | 488 | 77.3 |
13C chemical shifts | 382 | 345 | 90.3 |
15N chemical shifts | 22 | 5 | 22.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 83 | 77 | 92.8 |
13C chemical shifts | 83 | 80 | 96.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 32 | 68.1 |
13C chemical shifts | 46 | 31 | 67.4 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 EARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDE ||||| ||| ||||||||||||||||||||||||| || ||||||||||||||||||||||||||| ||||||||||||||||||||||||||| ...PIVVG...PLS.GLPGTENSDQARDGTLPYTKDRFYL.PL.PTEAAQRAKVSASEILNVKQFIDRKAW..LQNDLRLRASYLRYDLKTVISAKPKDE -------110-------120-------130-------140--------- KKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG ||||||||||||||||||||||||||||||||||||||||||||||||| KKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 EARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDE ||||||| ||||||||||||||||||||||||| |||||||||||||||||||||||||| | ...................................DRFYLQP.PPTEAAQRAKVSASEILNVKQFIDR.AWPSLQNDLRLRASYLRYDLKTVISA....E --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140--------- KKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG |||||||||||||||||||||||| |||||||||||||||||||||| KKSLQELTSKLFSSIDNLDHAAKI..PTEAEKYYGQTVSNINEVLAKL -------110-------120-------130-------140--------