BMRBj - BMREntryMaster

Found 1 Document (0.574 seconds)

BMRB: 25396

2MXB

assignment of the transmembrane domain of the mouse erythropoietin receptor

Authors

Li, Q., Wong, Y., Lee, M., Kang, C.

Assembly

mouse EpoR

Entity

1. mouse EpoR (polymer, Thiol state: not present), 55 monomers, 6244.356 Da Detail

MSEPASLLTA SDLDPLILTL SLILVLISLL LTVLALLSHR RTLQQKIWPH HHHHH

Formula weight

6244.356 Da

Source organism

Exptl. method

Refine. method

simulated annealing

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 85.5 %, Completeness: 55.0 %, Completeness (bb): 81.5 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	55.0 % (364 of 662)	53.1 % (179 of 337)	51.9 % (140 of 270)	81.8 % (45 of 55)
Backbone	81.5 % (264 of 324)	80.4 % (86 of 107)	81.8 % (135 of 165)	82.7 % (43 of 52)
Sidechain	36.1 % (142 of 393)	39.6 % (91 of 230)	31.3 % (50 of 160)	33.3 % (1 of 3)
Aromatic	5.0 % (2 of 40)	5.0 % (1 of 20)	0.0 % (0 of 19)	100.0 % (1 of 1)
Methyl	42.2 % (43 of 102)	72.5 % (37 of 51)	11.8 % (6 of 51)

1. mouse EpoR

MSEPASLLTA SDLDPLILTL SLILVLISLL LTVLALLSHR RTLQQKIWPH HHHHH

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Type	Concentration
1	mouseEpoR	[U-100% 15N]	protein	0.5 mM
2	sodium phosphate	natural abundance	buffer	20 mM
3	DPC	natural abundance		150 mM
4	H2O	natural abundance	solvent	90 %
5	D2O	U-2H	solvent	10 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Type	Concentration
6	mouseEpoR	[U-100% 13C; U-100% 15N]	protein	0.8 mM
7	sodium phosphate	natural abundance	buffer	20 mM
8	DPC	[U-100% 2H]		240 mM
9	H2O	natural abundance	solvent	90 %
10	D2O	U-2H	solvent	10 %

Protein Blocks Logo

Calculated from 20 models in PDB: 2MXB, Strand ID: A Detail

Release date

2015-09-20

Citation

Solution structure of the transmembrane domain of the mouse erythropoietin receptor in detergent micelles
Li, Q., Wong, Y., Lee, M.Y., Li, M., kang, C.
Sci. Rep. (2015), 5, 13586-13586, PubMed 26316120 , DOI 10.1038/srep13586 , Abstract

Related entities 1. mouse EpoR, : 1 : 2 : 8 entities Detail

Interaction partners 1. mouse EpoR, : 5 interactors Detail

More details for 5 interactors identified by 4 citations

Experiments performed 8 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Type	Concentration
1	mouseEpoR	[U-100% 15N]	protein	0.5 mM
2	sodium phosphate	natural abundance	buffer	20 mM
3	DPC	natural abundance		150 mM
4	H2O	natural abundance	solvent	90 %
5	D2O	U-2H	solvent	10 %

2 2D 1H-15N HSQC

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Type	Concentration
1	mouseEpoR	[U-100% 15N]	protein	0.5 mM
2	sodium phosphate	natural abundance	buffer	20 mM
3	DPC	natural abundance		150 mM
4	H2O	natural abundance	solvent	90 %
5	D2O	U-2H	solvent	10 %

3 3D HNCACB

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Type	Concentration
6	mouseEpoR	[U-100% 13C; U-100% 15N]	protein	0.8 mM
7	sodium phosphate	natural abundance	buffer	20 mM
8	DPC	[U-100% 2H]		240 mM
9	H2O	natural abundance	solvent	90 %
10	D2O	U-2H	solvent	10 %

4 3D HNCA

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Type	Concentration
6	mouseEpoR	[U-100% 13C; U-100% 15N]	protein	0.8 mM
7	sodium phosphate	natural abundance	buffer	20 mM
8	DPC	[U-100% 2H]		240 mM
9	H2O	natural abundance	solvent	90 %
10	D2O	U-2H	solvent	10 %

5 3D HNCO

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Type	Concentration
6	mouseEpoR	[U-100% 13C; U-100% 15N]	protein	0.8 mM
7	sodium phosphate	natural abundance	buffer	20 mM
8	DPC	[U-100% 2H]		240 mM
9	H2O	natural abundance	solvent	90 %
10	D2O	U-2H	solvent	10 %

6 3D HBHA(CO)NH

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Type	Concentration
6	mouseEpoR	[U-100% 13C; U-100% 15N]	protein	0.8 mM
7	sodium phosphate	natural abundance	buffer	20 mM
8	DPC	[U-100% 2H]		240 mM
9	H2O	natural abundance	solvent	90 %
10	D2O	U-2H	solvent	10 %

7 3D 1H-15N NOESY

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Type	Concentration
6	mouseEpoR	[U-100% 13C; U-100% 15N]	protein	0.8 mM
7	sodium phosphate	natural abundance	buffer	20 mM
8	DPC	[U-100% 2H]		240 mM
9	H2O	natural abundance	solvent	90 %
10	D2O	U-2H	solvent	10 %

8 3D HN(CO)CA

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5

#	Name	Isotope labeling	Type	Concentration
6	mouseEpoR	[U-100% 13C; U-100% 15N]	protein	0.8 mM
7	sodium phosphate	natural abundance	buffer	20 mM
8	DPC	[U-100% 2H]		240 mM
9	H2O	natural abundance	solvent	90 %
10	D2O	U-2H	solvent	10 %

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_25396_2mxb.nef
Input source #2: Coordindates	2mxb.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50-----
MSEPASLLTASDLDPLILTLSLILVLISLLLTVLALLSHRRTLQQKIWPHHHHHH
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
MSEPASLLTASDLDPLILTLSLILVLISLLLTVLALLSHRRTLQQKIWPHHHHHH

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	55	0	0	100.0

Content subtype: combined_25396_2mxb.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	365		85.5 (chain: A, length: 55)
1	Distance restraints	CNS/XPLOR_distance_constraints_4	OK	275 (1)	noe	85.5 (chain: A, length: 55)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_2	OK	90 (90)	.	87.3 (chain: A, length: 55)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 55, Sequence coverage: 85.5%
- Total number of assignments
  - ¹H chemical shifts: 184
  - ¹³C chemical shifts: 136
  - ¹⁵N chemical shifts: 45
- Completeness of assignments
  - Entity_assemble_ID: A
- Peptide bond of PRO
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_4
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 55, Sequence coverage: 85.5%
- Total number of restraints: 275
- Weight of restraints: 1.0 (275)
- Potential type of restraints: square-well-parabolic (275)
- Range of distance target values: 2.37, 3.9 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_2
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 55, Sequence coverage: 87.3%
- Total number of restraints: 90
- Total number of restraints per polymer type: 90
- Weight of restraints: 1.0 (90)
- Potential type of restraints: square-well-parabolic (90)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A