NMR structure of N-terminal domain from A. ventricosus minor ampullate spidroin (MiSp) at pH 7.2
GSGNSQPIWT NPNAAMTMTN NLVQCASRSG VLTADQMDDM GMMADSVNSQ MQKMGPNPPQ HRLRAMNTAM AAEVAEVVAT SPPQSYSAVL NTIGACLRES MMQATGSVDN AFTNEVMQLV KMLSADSANE VST
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS25:SG | 1:CYS96:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.1 % (1329 of 1413) | 93.4 % (680 of 728) | 94.4 % (507 of 537) | 95.9 % (142 of 148) |
Backbone | 93.9 % (736 of 784) | 92.9 % (247 of 266) | 93.6 % (367 of 392) | 96.8 % (122 of 126) |
Sidechain | 94.8 % (716 of 755) | 93.7 % (433 of 462) | 97.0 % (263 of 271) | 90.9 % (20 of 22) |
Aromatic | 100.0 % (34 of 34) | 100.0 % (17 of 17) | 100.0 % (16 of 16) | 100.0 % (1 of 1) |
Methyl | 99.3 % (133 of 134) | 98.5 % (66 of 67) | 100.0 % (67 of 67) |
1. entity
GSGNSQPIWT NPNAAMTMTN NLVQCASRSG VLTADQMDDM GMMADSVNSQ MQKMGPNPPQ HRLRAMNTAM AAEVAEVVAT SPPQSYSAVL NTIGACLRES MMQATGSVDN AFTNEVMQLV KMLSADSANE VSTSolvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.03 % | |
5 | protease inhibitor cocktail | natural abundance | 0.01 tablet/100mL |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.77 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.77 ppm | internal | direct | 1.0 |
15N | water | protons | 4.77 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.77 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.77 ppm | internal | direct | 1.0 |
15N | water | protons | 4.77 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.77 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.77 ppm | internal | direct | 1.0 |
15N | water | protons | 4.77 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.77 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.77 ppm | internal | direct | 1.0 |
15N | water | protons | 4.77 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 600 MHz equipped with HCN cold probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.03 % | |
5 | protease inhibitor cocktail | natural abundance | 0.01 tablet/100mL |
Varian INOVA - 600 MHz equipped with HCN cold probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.03 % | |
5 | protease inhibitor cocktail | natural abundance | 0.01 tablet/100mL |
Varian INOVA - 600 MHz equipped with HCN cold probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.03 % | |
5 | protease inhibitor cocktail | natural abundance | 0.01 tablet/100mL |
Varian INOVA - 600 MHz equipped with HCN cold probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.03 % | |
5 | protease inhibitor cocktail | natural abundance | 0.01 tablet/100mL |
Varian INOVA - 600 MHz equipped with HCN cold probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.03 % | |
5 | protease inhibitor cocktail | natural abundance | 0.01 tablet/100mL |
Varian INOVA - 600 MHz equipped with HCN cold probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.03 % | |
5 | protease inhibitor cocktail | natural abundance | 0.01 tablet/100mL |
Varian INOVA - 600 MHz equipped with HCN cold probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.03 % | |
5 | protease inhibitor cocktail | natural abundance | 0.01 tablet/100mL |
Varian INOVA - 600 MHz equipped with HCN cold probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.03 % | |
5 | protease inhibitor cocktail | natural abundance | 0.01 tablet/100mL |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_25397_2mx8.nef |
Input source #2: Coordindates | 2mx8.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:25:CYS:SG | A:96:CYS:SG | oxidized, CA 59.518, CB 35.688 ppm | oxidized, CA 56.134, CB 37.206 ppm | 2.034 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSGNSQPIWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMGPNPPQHRLRAMNTAMAAEVAEVVATSPPQSYSAVLNTIGACLRES |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSGNSQPIWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMGPNPPQHRLRAMNTAMAAEVAEVVATSPPQSYSAVLNTIGACLRES -------110-------120-------130--- MMQATGSVDNAFTNEVMQLVKMLSADSANEVST ||||||||||||||||||||||||||||||||| MMQATGSVDNAFTNEVMQLVKMLSADSANEVST
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 133 | 0 | 0 | 100.0 |
Content subtype: combined_25397_2mx8.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSGNSQPIWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMGPNPPQHRLRAMNTAMAAEVAEVVATSPPQSYSAVLNTIGACLRES ||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||| |||||||||||||||||| ....SQPIWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMGPNPP.HRLRAMNTAMAAEVAEVVATS.PQSYSAVLNTIGACLRES -------110-------120-------130--- MMQATGSVDNAFTNEVMQLVKMLSADSANEVST ||||||||||||||||||||||||||||||||| MMQATGSVDNAFTNEVMQLVKMLSADSANEVST
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
10 | THR | HG1 | 5.058 |
19 | THR | HG1 | 4.925 |
29 | SER | HG | 5.645 |
81 | SER | HG | 5.691 |
92 | THR | HG1 | 5.193 |
100 | SER | HG | 4.714 |
124 | SER | HG | 5.705 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 728 | 688 | 94.5 |
13C chemical shifts | 537 | 504 | 93.9 |
15N chemical shifts | 152 | 140 | 92.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 266 | 250 | 94.0 |
13C chemical shifts | 266 | 241 | 90.6 |
15N chemical shifts | 126 | 120 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 462 | 438 | 94.8 |
13C chemical shifts | 271 | 263 | 97.0 |
15N chemical shifts | 26 | 20 | 76.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 81 | 81 | 100.0 |
13C chemical shifts | 81 | 81 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 17 | 17 | 100.0 |
13C chemical shifts | 16 | 16 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSGNSQPIWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMGPNPPQHRLRAMNTAMAAEVAEVVATSPPQSYSAVLNTIGACLRES ||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||| |||||||||||||||||| ....SQPIWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMGPNPP.HRLRAMNTAMAAEVAEVVATS.PQSYSAVLNTIGACLRES -------110-------120-------130--- MMQATGSVDNAFTNEVMQLVKMLSADSANEVST ||||||||||||||||||||||||||||||||| MMQATGSVDNAFTNEVMQLVKMLSADSANEVST