Solution structure of firefly light organ fatty acid binding protein (lcFABP)
MVQLAGTYKL EKNENFEEYL AALGVPQDSI KKANSPGVVY EIIVNGNKFT FKSSSGMNST LIVNEEVEEV LGTVNMNIKS FTKLEGSKLV VNSELPDGRK GTRTYEFCDK GFVLTMCAGD MVAKRYFIRT
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.0 % (1366 of 1517) | 90.3 % (711 of 787) | 87.6 % (518 of 591) | 98.6 % (137 of 139) |
Backbone | 99.2 % (768 of 774) | 98.5 % (264 of 268) | 100.0 % (379 of 379) | 98.4 % (125 of 127) |
Sidechain | 83.3 % (718 of 862) | 86.3 % (448 of 519) | 77.9 % (258 of 331) | 100.0 % (12 of 12) |
Aromatic | 18.2 % (20 of 110) | 29.1 % (16 of 55) | 7.3 % (4 of 55) | |
Methyl | 90.4 % (132 of 146) | 94.5 % (69 of 73) | 86.3 % (63 of 73) |
1. lcFABP
MVQLAGTYKL EKNENFEEYL AALGVPQDSI KKANSPGVVY EIIVNGNKFT FKSSSGMNST LIVNEEVEEV LGTVNMNIKS FTKLEGSKLV VNSELPDGRK GTRTYEFCDK GFVLTMCAGD MVAKRYFIRTSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lcFABP | [U-98% 13C; U-98% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | L-Arg | natural abundance | 50 mM | |
6 | D2O | natural abundance | 10 % | |
7 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25400_2n93.nef |
Input source #2: Coordindates | 2n93.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVQLAGTYKLEKNENFEEYLAALGVPQDSIKKANSPGVVYEIIVNGNKFTFKSSSGMNSTLIVNEEVEEVLGTVNMNIKSFTKLEGSKLVVNSELPDGRK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVQLAGTYKLEKNENFEEYLAALGVPQDSIKKANSPGVVYEIIVNGNKFTFKSSSGMNSTLIVNEEVEEVLGTVNMNIKSFTKLEGSKLVVNSELPDGRK -------110-------120-------130 GTRTYEFCDKGFVLTMCAGDMVAKRYFIRT |||||||||||||||||||||||||||||| GTRTYEFCDKGFVLTMCAGDMVAKRYFIRT
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 130 | 0 | 0 | 100.0 |
Content subtype: combined_25400_2n93.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVQLAGTYKLEKNENFEEYLAALGVPQDSIKKANSPGVVYEIIVNGNKFTFKSSSGMNSTLIVNEEVEEVLGTVNMNIKSFTKLEGSKLVVNSELPDGRK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVQLAGTYKLEKNENFEEYLAALGVPQDSIKKANSPGVVYEIIVNGNKFTFKSSSGMNSTLIVNEEVEEVLGTVNMNIKSFTKLEGSKLVVNSELPDGRK -------110-------120-------130 GTRTYEFCDKGFVLTMCAGDMVAKRYFIRT |||||||||||||||||||||||||||||| GTRTYEFCDKGFVLTMCAGDMVAKRYFIRT
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 787 | 713 | 90.6 |
13C chemical shifts | 591 | 512 | 86.6 |
15N chemical shifts | 143 | 136 | 95.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 268 | 265 | 98.9 |
13C chemical shifts | 260 | 260 | 100.0 |
15N chemical shifts | 127 | 124 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 519 | 448 | 86.3 |
13C chemical shifts | 331 | 252 | 76.1 |
15N chemical shifts | 16 | 12 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 70 | 89.7 |
13C chemical shifts | 78 | 63 | 80.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 14 | 25.5 |
13C chemical shifts | 55 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVQLAGTYKLEKNENFEEYLAALGVPQDSIKKANSPGVVYEIIVNGNKFTFKSSSGMNSTLIVNEEVEEVLGTVNMNIKSFTKLEGSKLVVNSELPDGRK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVQLAGTYKLEKNENFEEYLAALGVPQDSIKKANSPGVVYEIIVNGNKFTFKSSSGMNSTLIVNEEVEEVLGTVNMNIKSFTKLEGSKLVVNSELPDGRK -------110-------120-------130 GTRTYEFCDKGFVLTMCAGDMVAKRYFIRT |||||||||||||||||||||||||||||| GTRTYEFCDKGFVLTMCAGDMVAKRYFIRT
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVQLAGTYKLEKNENFEEYLAALGVPQDSIKKANSPGVVYEIIVNGNKFTFKSSSGMNSTLIVNEEVEEVLGTVNMNIKSFTKLEGSKLVVNSELPDGRK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVQLAGTYKLEKNENFEEYLAALGVPQDSIKKANSPGVVYEIIVNGNKFTFKSSSGMNSTLIVNEEVEEVLGTVNMNIKSFTKLEGSKLVVNSELPDGRK -------110-------120-------130 GTRTYEFCDKGFVLTMCAGDMVAKRYFIRT |||||||||||||||||||||||||||||| GTRTYEFCDKGFVLTMCAGDMVAKRYFIRT