Solution NMR structure of Salmonella typhimurium transcriptional regulator protein Crl
HHHHHHSSGT GSGENLYFQG HMTLPSGHPK SRLIKKFTAL GPYIREGQCE DNRFFFDCLA VCVNVKPAPE KREFWGWWME LEAQEKRFTY RYQFGLFDKE GNWTVVPINE TEVVERLEYT LREFHEKLRD LLISMELALE PSDDFNDEPV KLSA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.1 % (1518 of 1872) | 81.5 % (797 of 978) | 79.4 % (583 of 734) | 86.3 % (138 of 160) |
Backbone | 88.8 % (806 of 908) | 89.4 % (277 of 310) | 88.7 % (401 of 452) | 87.7 % (128 of 146) |
Sidechain | 76.0 % (842 of 1108) | 77.8 % (520 of 668) | 73.2 % (312 of 426) | 71.4 % (10 of 14) |
Aromatic | 52.1 % (122 of 234) | 71.8 % (84 of 117) | 30.1 % (34 of 113) | 100.0 % (4 of 4) |
Methyl | 97.8 % (131 of 134) | 97.0 % (65 of 67) | 98.5 % (66 of 67) |
1. His ST-Crl
HHHHHHSSGT GSGENLYFQG HMTLPSGHPK SRLIKKFTAL GPYIREGQCE DNRFFFDCLA VCVNVKPAPE KREFWGWWME LEAQEKRFTY RYQFGLFDKE GNWTVVPINE TEVVERLEYT LREFHEKLRD LLISMELALE PSDDFNDEPV KLSASolvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | His_ST-Crl | [U-98% 15N] | 0.3 (±0.03) mM | |
2 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
3 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
4 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | His_ST-Crl | [U-98% 13C; U-98% 15N] | 0.25 (±0.25) mM | |
8 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
9 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
10 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
11 | D2O | natural abundance | 7 % | |
12 | H2O | natural abundance | 93 % |
Solvent system 100% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | His_ST-Crl | [U-98% 13C; U-98% 15N] | 0.35 (±0.04) mM | |
14 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
15 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
16 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
17 | D2O | natural abundance | 100 % |
Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | His_ST-Crl | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.300 (±0.03) mM | |
19 | Sodium phosphate | natural abundance | 50.000 (±5.0) mM | |
20 | Sodium chloride | natural abundance | 300.000 (±30.0) mM | |
21 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
22 | D2O | natural abundance | 7 % | |
23 | H2O | natural abundance | 93 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | His_ST-Crl | [U-98% 15N] | 0.3 (±0.03) mM | |
2 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
3 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
4 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | His_ST-Crl | [U-98% 15N] | 0.3 (±0.03) mM | |
2 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
3 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
4 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | His_ST-Crl | [U-98% 15N] | 0.3 (±0.03) mM | |
2 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
3 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
4 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | His_ST-Crl | [U-98% 13C; U-98% 15N] | 0.25 (±0.25) mM | |
8 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
9 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
10 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
11 | D2O | natural abundance | 7 % | |
12 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 6.500
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | His_ST-Crl | [U-98% 13C; U-98% 15N] | 0.25 (±0.25) mM | |
8 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
9 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
10 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
11 | D2O | natural abundance | 7 % | |
12 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | His_ST-Crl | [U-98% 13C; U-98% 15N] | 0.25 (±0.25) mM | |
8 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
9 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
10 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
11 | D2O | natural abundance | 7 % | |
12 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | His_ST-Crl | [U-98% 13C; U-98% 15N] | 0.25 (±0.25) mM | |
8 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
9 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
10 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
11 | D2O | natural abundance | 7 % | |
12 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | His_ST-Crl | [U-98% 13C; U-98% 15N] | 0.25 (±0.25) mM | |
8 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
9 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
10 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
11 | D2O | natural abundance | 7 % | |
12 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | His_ST-Crl | [U-98% 13C; U-98% 15N] | 0.25 (±0.25) mM | |
8 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
9 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
10 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
11 | D2O | natural abundance | 7 % | |
12 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | His_ST-Crl | [U-98% 13C; U-98% 15N] | 0.25 (±0.25) mM | |
8 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
9 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
10 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
11 | D2O | natural abundance | 7 % | |
12 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | His_ST-Crl | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.300 (±0.03) mM | |
19 | Sodium phosphate | natural abundance | 50.000 (±5.0) mM | |
20 | Sodium chloride | natural abundance | 300.000 (±30.0) mM | |
21 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
22 | D2O | natural abundance | 7 % | |
23 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | His_ST-Crl | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.300 (±0.03) mM | |
19 | Sodium phosphate | natural abundance | 50.000 (±5.0) mM | |
20 | Sodium chloride | natural abundance | 300.000 (±30.0) mM | |
21 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
22 | D2O | natural abundance | 7 % | |
23 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | His_ST-Crl | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.300 (±0.03) mM | |
19 | Sodium phosphate | natural abundance | 50.000 (±5.0) mM | |
20 | Sodium chloride | natural abundance | 300.000 (±30.0) mM | |
21 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
22 | D2O | natural abundance | 7 % | |
23 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | His_ST-Crl | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.300 (±0.03) mM | |
19 | Sodium phosphate | natural abundance | 50.000 (±5.0) mM | |
20 | Sodium chloride | natural abundance | 300.000 (±30.0) mM | |
21 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
22 | D2O | natural abundance | 7 % | |
23 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | His_ST-Crl | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.300 (±0.03) mM | |
19 | Sodium phosphate | natural abundance | 50.000 (±5.0) mM | |
20 | Sodium chloride | natural abundance | 300.000 (±30.0) mM | |
21 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
22 | D2O | natural abundance | 7 % | |
23 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | His_ST-Crl | [U-98% 13C; U-98% 15N] | 0.35 (±0.04) mM | |
14 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
15 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
16 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
17 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | His_ST-Crl | [U-98% 13C; U-98% 15N] | 0.35 (±0.04) mM | |
14 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
15 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
16 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
17 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | His_ST-Crl | [U-98% 13C; U-98% 15N] | 0.35 (±0.04) mM | |
14 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
15 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
16 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
17 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 8.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | His_ST-Crl | [U-98% 13C; U-98% 15N] | 0.35 (±0.04) mM | |
14 | Sodium phosphate | natural abundance | 50.0 (±5.0) mM | |
15 | Sodium chloride | natural abundance | 300.0 (±30.0) mM | |
16 | Dithiotreitol | natural abundance | 2.0 (±0.2) mM | |
17 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25476_2mz8.nef |
Input source #2: Coordindates | 2mz8.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------------------------10--------20--------30--------40--------50--------60--------70--------8 HHHHHHSSGTGSGENLYFQGHMTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HHHHHHSSGTGSGENLYFQGHMTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0--------90-------100-------110-------120-------130--- GNWTVVPINETEVVERLEYTLREFHEKLRDLLISMELALEPSDDFNDEPVKLSA |||||||||||||||||||||||||||||||||||||||||||||||||||||| GNWTVVPINETEVVERLEYTLREFHEKLRDLLISMELALEPSDDFNDEPVKLSA -------110-------120-------130-------140-------150----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 154 | 0 | 0 | 100.0 |
Content subtype: combined_25476_2mz8.nef
Assigned chemical shifts
-----------------------------10--------20--------30--------40--------50--------60--------70--------8 HHHHHHSSGTGSGENLYFQGHMTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKE |||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| ....HHSSGTGSGENLYFQGHMTLPSGHPKSRLIKKFTALGPYIREGQCE.NRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKE 0--------90-------100-------110-------120-------130--- GNWTVVPINETEVVERLEYTLREFHEKLRDLLISMELALEPSDDFNDEPVKLSA ||||||||| |||||||||||||||||||||||||||||||||||||||||||| GNWTVVPIN.TEVVERLEYTLREFHEKLRDLLISMELALEPSDDFNDEPVKLSA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
27 | GLN | CD | 179.15 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 978 | 787 | 80.5 |
13C chemical shifts | 734 | 569 | 77.5 |
15N chemical shifts | 169 | 131 | 77.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 310 | 274 | 88.4 |
13C chemical shifts | 308 | 265 | 86.0 |
15N chemical shifts | 146 | 121 | 82.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 668 | 513 | 76.8 |
13C chemical shifts | 426 | 304 | 71.4 |
15N chemical shifts | 23 | 10 | 43.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 69 | 98.6 |
13C chemical shifts | 70 | 69 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 117 | 82 | 70.1 |
13C chemical shifts | 113 | 32 | 28.3 |
15N chemical shifts | 4 | 4 | 100.0 |
Distance restraints
-----------------------------10--------20--------30--------40--------50--------60--------70--------8 HHHHHHSSGTGSGENLYFQGHMTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKE ||||| ||||||||||||||||||| | | |||||||||||||||||||||||||||| |||||||||||||||||||| .....................MTLPS.HPKSRLIKKFTALGPYIRE.Q.E.NRFFFDCLAVCVNVKPAPEKREFWGWWM.LEAQEKRFTYRYQFGLFDKE 0--------90-------100-------110-------120-------130--- GNWTVVPINETEVVERLEYTLREFHEKLRDLLISMELALEPSDDFNDEPVKLSA || |||||| ||||||||||||||||||||||||||||||||||| ||| ||| GN.TVVPIN.TEVVERLEYTLREFHEKLRDLLISMELALEPSDDF..EPV.LSA
Dihedral angle restraints
-----------------------------10--------20--------30--------40--------50--------60--------70--------8 HHHHHHSSGTGSGENLYFQGHMTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKE ||||||||||||||||||||||||| ||||||||||||||||||||||||| ||||||||||||||||||||||| .....................MTLPSGHPKSRLIKKFTALGPYIRE.....NRFFFDCLAVCVNVKPAPEKREFWG.WMELEAQEKRFTYRYQFGLFDKE 0--------90-------100-------110-------120-------130--- GNWTVVPINETEVVERLEYTLREFHEKLRDLLISMELALEPSDDFNDEPVKLSA |||||||||||||||||||||||||||||||||||||||||||||| |||||| GNWTVVPINETEVVERLEYTLREFHEKLRDLLISMELALEPSDDFN..PVKLSA