Human Med26 N-Terminal Domain (1-92)
GMTAAPASPQ QIRDRLLQAI DPQSNIRNMV AVLEVISSLE KYPITKEALE ETRLGKLIND VRKKTKNEEL AKRAKKLLRS WQKLIEPAHQ HEA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.0 % (957 of 1126) | 76.6 % (458 of 598) | 93.9 % (403 of 429) | 97.0 % (96 of 99) |
Backbone | 96.0 % (526 of 548) | 94.0 % (172 of 183) | 96.8 % (268 of 277) | 97.7 % (86 of 88) |
Sidechain | 77.9 % (521 of 669) | 68.9 % (286 of 415) | 92.6 % (225 of 243) | 90.9 % (10 of 11) |
Aromatic | 71.4 % (20 of 28) | 78.6 % (11 of 14) | 61.5 % (8 of 13) | 100.0 % (1 of 1) |
Methyl | 99.1 % (115 of 116) | 98.3 % (57 of 58) | 100.0 % (58 of 58) |
1. entity
GMTAAPASPQ QIRDRLLQAI DPQSNIRNMV AVLEVISSLE KYPITKEALE ETRLGKLIND VRKKTKNEEL AKRAKKLLRS WQKLIEPAHQ HEASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.4 ~ 1.4 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 2.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-100% 13C; U-100% 15N] | 0.4 ~ 1.4 mM | |
9 | HEPES | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DTT | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 2.5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 15N] | 0.4 ~ 1.4 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 2.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-100% 13C; U-100% 15N] | 0.4 ~ 1.4 mM | |
9 | HEPES | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DTT | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 2.5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-100% 13C; U-100% 15N] | 0.4 ~ 1.4 mM | |
9 | HEPES | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DTT | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 2.5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-100% 13C; U-100% 15N] | 0.4 ~ 1.4 mM | |
9 | HEPES | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DTT | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 2.5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-100% 13C; U-100% 15N] | 0.4 ~ 1.4 mM | |
9 | HEPES | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DTT | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 2.5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-100% 13C; U-100% 15N] | 0.4 ~ 1.4 mM | |
9 | HEPES | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DTT | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 2.5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-100% 13C; U-100% 15N] | 0.4 ~ 1.4 mM | |
9 | HEPES | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DTT | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 2.5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-100% 13C; U-100% 15N] | 0.4 ~ 1.4 mM | |
9 | HEPES | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DTT | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 2.5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-100% 13C; U-100% 15N] | 0.4 ~ 1.4 mM | |
9 | HEPES | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DTT | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 2.5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-100% 13C; U-100% 15N] | 0.4 ~ 1.4 mM | |
9 | HEPES | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DTT | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 2.5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-100% 13C; U-100% 15N] | 0.4 ~ 1.4 mM | |
9 | HEPES | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DTT | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 2.5 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25493_5odd.nef |
Input source #2: Coordindates | 5odd.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPAHQHEA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPAHQHEA
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 92 | 0 | 0 | 100.0 |
Content subtype: combined_25493_5odd.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPAHQHEA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPAHQHEA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 427 | 402 | 94.1 |
1H chemical shifts | 595 | 454 | 76.3 |
15N chemical shifts | 105 | 95 | 90.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 184 | 178 | 96.7 |
1H chemical shifts | 180 | 176 | 97.8 |
15N chemical shifts | 87 | 85 | 97.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 243 | 224 | 92.2 |
1H chemical shifts | 415 | 278 | 67.0 |
15N chemical shifts | 18 | 10 | 55.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 60 | 57 | 95.0 |
1H chemical shifts | 60 | 57 | 95.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 13 | 8 | 61.5 |
1H chemical shifts | 14 | 11 | 78.6 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPAHQHEA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..AAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPAHQHEA
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPAHQHEA ||||||||| ||||||||||| || || |||||||||| |||||||||||||||| .......PQQIRDRLL...........MVAVLEVISSL......KE.LE..RLGKLINDVR.....EELAKRAKKLLRSWQK --------10--------20--------30--------40--------50--------60--------70--------80--
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPAHQHEA |||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||| MTAA.ASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIE.AHQHEA