Solution Structure of the phosphorylated J-domain of Human Cysteine String Protein (CSP)
MRSPGMADQR QRSLXTSGES LYHVLGLDKN ATSDDIKKSY RKLALKYHPD KNPDNPEAAD KFKEINNAHA ILTDATKRNI YDKYGSLGLY VAEQFGEENV NTYFV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.4 % (1062 of 1215) | 87.4 % (556 of 636) | 85.5 % (400 of 468) | 95.5 % (106 of 111) |
Backbone | 94.2 % (580 of 616) | 94.3 % (198 of 210) | 93.8 % (287 of 306) | 95.0 % (95 of 100) |
Sidechain | 81.9 % (571 of 697) | 83.1 % (354 of 426) | 79.2 % (206 of 260) | 100.0 % (11 of 11) |
Aromatic | 20.4 % (20 of 98) | 20.4 % (10 of 49) | 20.4 % (10 of 49) | |
Methyl | 100.0 % (96 of 96) | 100.0 % (48 of 48) | 100.0 % (48 of 48) |
1. Phosphorylated DnaJ domain of cysteine-string protein
MRSPGMADQR QRSLXTSGES LYHVLGLDKN ATSDDIKKSY RKLALKYHPD KNPDNPEAAD KFKEINNAHA ILTDATKRNI YDKYGSLGLY VAEQFGEENV NTYFVSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphorylated DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | MgCl2 | natural abundance | 10 mM | |
6 | EDTA | natural abundance | 0.5 mM | |
7 | PKA | natural abundance | 0.73 nM | |
8 | ATP | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25514_2n04.nef |
Input source #2: Coordindates | 2n04.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:14:LEU:C | 1:15:SEP:N | unknown | unknown | n/a |
1:15:SEP:C | 1:16:THR:N | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
A | 10 | SEP | PHOSPHOSERINE | Coordinates |
Sequence alignments
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- MRSPGMADQRQRSLXTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRSPGMADQRQRSLXTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --100 NTYFV ||||| NTYFV -----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 105 | 0 | 0 | 100.0 |
Content subtype: combined_25514_2n04.nef
Assigned chemical shifts
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- MRSPGMADQRQRSLXTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV ||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....MADQRQRSL.TSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV --100 NTYFV ||||| NTYFV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 640 | 553 | 86.4 |
13C chemical shifts | 470 | 400 | 85.1 |
15N chemical shifts | 117 | 106 | 90.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 212 | 199 | 93.9 |
13C chemical shifts | 209 | 195 | 93.3 |
15N chemical shifts | 101 | 95 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 428 | 354 | 82.7 |
13C chemical shifts | 261 | 205 | 78.5 |
15N chemical shifts | 16 | 11 | 68.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 48 | 96.0 |
13C chemical shifts | 50 | 48 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 10 | 20.4 |
13C chemical shifts | 49 | 10 | 20.4 |
Covalent bonds
Distance restraints
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- MRSPGMADQRQRSLXTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV ||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....MADQRQRSL.TSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV --100 NTYFV ||||| NTYFV
Dihedral angle restraints
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- MRSPGMADQRQRSLXTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV |||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .RSPGMADQRQRS...SGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV -------------10--------20--------30--------40--------50--------60--------70--------80--------90----- --100 NTYFV |||| NTYF ----