Solution Structure of the non-phosphorylated J-domain of Human Cysteine String Protein (CSP)
MRSPGMADQR QRSLSTSGES LYHVLGLDKN ATSDDIKKSY RKLALKYHPD KNPDNPEAAD KFKEINNAHA ILTDATKRNI YDKYGSLGLY VAEQFGEENV NTYFV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.0 % (1089 of 1223) | 88.0 % (563 of 640) | 89.4 % (421 of 471) | 93.8 % (105 of 112) |
Backbone | 92.9 % (578 of 622) | 92.5 % (196 of 212) | 92.9 % (287 of 309) | 94.1 % (95 of 101) |
Sidechain | 86.1 % (603 of 700) | 85.7 % (367 of 428) | 86.6 % (226 of 261) | 90.9 % (10 of 11) |
Aromatic | 77.6 % (76 of 98) | 77.6 % (38 of 49) | 77.6 % (38 of 49) | |
Methyl | 100.0 % (96 of 96) | 100.0 % (48 of 48) | 100.0 % (48 of 48) |
1. DnaJ domain of cysteine-string protein
MRSPGMADQR QRSLSTSGES LYHVLGLDKN ATSDDIKKSY RKLALKYHPD KNPDNPEAAD KFKEINNAHA ILTDATKRNI YDKYGSLGLY VAEQFGEENV NTYFVSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaJ domain of cysteine-string protein | [U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaJ domain of cysteine-string protein | [U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaJ domain of cysteine-string protein | [U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DnaJ domain of cysteine-string protein | [U-13C; U-15N] | 0.5 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25515_2n05.nef |
Input source #2: Coordindates | 2n05.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- MRSPGMADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRSPGMADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --100 NTYFV ||||| NTYFV -----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 105 | 0 | 0 | 100.0 |
Content subtype: combined_25515_2n05.nef
Assigned chemical shifts
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- MRSPGMADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......ADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV --100 NTYFV ||||| NTYFV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 640 | 555 | 86.7 |
13C chemical shifts | 471 | 410 | 87.0 |
15N chemical shifts | 117 | 104 | 88.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 212 | 196 | 92.5 |
13C chemical shifts | 210 | 191 | 91.0 |
15N chemical shifts | 101 | 94 | 93.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 428 | 359 | 83.9 |
13C chemical shifts | 261 | 219 | 83.9 |
15N chemical shifts | 16 | 10 | 62.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 46 | 92.0 |
13C chemical shifts | 50 | 46 | 92.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 38 | 77.6 |
13C chemical shifts | 49 | 38 | 77.6 |
Distance restraints
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- MRSPGMADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .RSPGMADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV --100 NTYFV ||||| NTYFV
Dihedral angle restraints
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- MRSPGMADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENV |||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||| MRSPGMADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYH.DKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEEN -------------10--------20--------30--------40--------50--------60--------70--------80--------90---- --100 NTYFV