BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	98.8 % (599 of 606)	99.4 % (316 of 318)	98.3 % (232 of 236)	98.1 % (51 of 52)
Backbone	98.3 % (297 of 302)	99.0 % (102 of 103)	98.0 % (147 of 150)	98.0 % (48 of 49)
Sidechain	99.4 % (350 of 352)	99.5 % (214 of 215)	99.3 % (133 of 134)	100.0 % (3 of 3)
Aromatic	96.3 % (52 of 54)	96.3 % (26 of 27)	96.2 % (25 of 26)	100.0 % (1 of 1)
Methyl	100.0 % (48 of 48)	100.0 % (24 of 24)	100.0 % (24 of 24)

1. entity

GPLGSPNSGT KKYDLSKWKY AELRDTINTS CDIELLAACR EEFHRRLKVY H

Show sample condition

Sample

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 6.5, Details 20mM sodium phosphate buffer (pH 6.5), 50 mM NaCl, 2mM DTT, 0.1% NaN3.

#	Name	Isotope labeling	Concentration
1	entity	[U-13C; U-15N]	0.3 mM
2	sodium phosphate buffer	natural abundance	20 mM
3	NaCl	natural abundance	50 mM
4	DTT	natural abundance	2 mM
5	NaN3	natural abundance	0.1 %
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.09 ppm, Outliers: 2 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.09 ppm, Outliers: 2 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.09 ppm, Outliers: 2 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 2.18 ppm, Outliers: 2 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2N0Z, Strand ID: A Detail

Release date

2016-03-06

Citation

Myosin VI Contains a Compact Structural Motif that Binds to Ubiquitin Chains
He, F., Wollscheid, H., Nowicka, U., Biancospino, M., Valentini, E., Ehlinger, A., Acconcia, F., Magistrati, E., Polo, S., Walters, K.J.
Cell Rep. (2016), 14, 2683-2694, PubMed 26971995 , DOI 10.1016/j.celrep.2016.01.079 , Abstract

Related entities 1. MyUb (1080-1122) of human Myosin VI, : 1 : 1 : 1 : 21 entities Detail

Interaction partners 1. MyUb (1080-1122) of human Myosin VI, : 2 interactors Detail

More details for 2 interactors identified by 1 citations

Experiments performed 2 experiments Detail

NMR combined restraints 5 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_25541_2n0z.nef
Input source #2: Coordindates	2n0z.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50-
GPLGSPNSGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYH
|||||||||||||||||||||||||||||||||||||||||||||||||||
GPLGSPNSGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYH

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	51	0	0	100.0

Content subtype: combined_25541_2n0z.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	542		88.2 (chain: A, length: 51)
1	Distance restraints	DYANA/DIANA_distance_constraints_2	Warning	1066 (1)	noe	84.3 (chain: A, length: 51)
2	Distance restraints	DYANA/DIANA_distance_constraints_4	OK	40 (1)	hbond	54.9 (chain: A, length: 51)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_3	OK	54 (54)	.	70.6 (chain: A, length: 51)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 51, Sequence coverage: 88.2%
- Total number of assignments
  - ¹H chemical shifts: 283
  - ¹³C chemical shifts: 209
  - ¹⁵N chemical shifts: 50
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	318	283	89.0
¹³C chemical shifts	236	209	88.6
¹⁵N chemical shifts	56	50	89.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	103	90	87.4
¹³C chemical shifts	102	88	86.3
¹⁵N chemical shifts	49	43	87.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	215	193	89.8
¹³C chemical shifts	134	121	90.3
¹⁵N chemical shifts	7	7	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	24	22	91.7
¹³C chemical shifts	24	22	91.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	27	26	96.3
¹³C chemical shifts	26	25	96.2
¹⁵N chemical shifts	1	1	100.0

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_2
- Status: Warning
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 51, Sequence coverage: 84.3%
- Total number of restraints: 1066
- Weight of restraints: 1.0 (1066)
- Potential type of restraints: upper-bound-parabolic (1066)
- Range of distance target values: 2.78, 5.5 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: DYANA/DIANA_distance_constraints_4
  - Status: OK
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 51, Sequence coverage: 54.9%
  - Total number of restraints: 40
  - Weight of restraints: 1.0 (40)
  - Potential type of restraints: upper-bound-parabolic (40)
  - Range of distance target values: 2.0, 3.0 (Å)
  - Histogram of distance target values
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_3
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 51, Sequence coverage: 70.6%
- Total number of restraints: 54
- Total number of restraints per polymer type: 54
- Weight of restraints: 1.0 (54)
- Potential type of restraints: square-well-parabolic (54)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords MyUb, Myosin VI

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.621 seconds)

BMRB: 25541

Sample

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. MyUb (1080-1122) of human Myosin VI, : 1 : 1 : 1 : 21 entities Detail

Interaction partners 1. MyUb (1080-1122) of human Myosin VI, : 2 interactors Detail

Experiments performed 2 experiments Detail

Instrument

Sample

Instrument

Sample

NMR combined restraints 5 contents Detail