Structure of the Third Type III Domain from Human Fibronectin
GSHMGTTTAP DAPPDPTVDQ VDDTSIVVRW SRPQAPITGY RIVYSPSVEG SSTELNLPET ANSVTLSDLQ PGVQYNITIY AVEENQESTP VVIQQETTGT PRSDGT
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.9 % (1090 of 1137) | 96.2 % (561 of 583) | 96.4 % (431 of 447) | 91.6 % (98 of 107) |
Backbone | 94.1 % (578 of 614) | 93.8 % (195 of 208) | 95.5 % (297 of 311) | 90.5 % (86 of 95) |
Sidechain | 97.9 % (609 of 622) | 97.6 % (366 of 375) | 98.3 % (231 of 235) | 100.0 % (12 of 12) |
Aromatic | 100.0 % (48 of 48) | 100.0 % (24 of 24) | 100.0 % (23 of 23) | 100.0 % (1 of 1) |
Methyl | 98.4 % (122 of 124) | 98.4 % (61 of 62) | 98.4 % (61 of 62) |
1. entity
GSHMGTTTAP DAPPDPTVDQ VDDTSIVVRW SRPQAPITGY RIVYSPSVEG SSTELNLPET ANSVTLSDLQ PGVQYNITIY AVEENQESTP VVIQQETTGT PRSDGTSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-99% 15N] | 0.6 mM | |
9 | sodium phosphate | natural abundance | 10 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | potassium chloride | natural abundance | 2.7 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity | natural abundance | 0.6 mM | |
16 | sodium phosphate | natural abundance | 10 mM | |
17 | potassium phosphate | natural abundance | 1.8 mM | |
18 | sodium chloride | natural abundance | 140 mM | |
19 | potassium chloride | natural abundance | 2.7 mM | |
20 | H2O | natural abundance | 90 % | |
21 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | entity | natural abundance | 0.6 mM | |
23 | sodium phosphate | natural abundance | 10 mM | |
24 | potassium phosphate | natural abundance | 1.8 mM | |
25 | sodium chloride | natural abundance | 140 mM | |
26 | potassium chloride | natural abundance | 2.7 mM | |
27 | D2O | natural abundance | 100 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
28 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
29 | sodium phosphate | natural abundance | 10 mM | |
30 | potassium phosphate | natural abundance | 1.8 mM | |
31 | sodium chloride | natural abundance | 140 mM | |
32 | potassium chloride | natural abundance | 2.7 mM | |
33 | entity | natural abundance | 0.9 mM | |
34 | H2O | natural abundance | 90 % | |
35 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.755 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.755 ppm | internal | direct | 1.0 |
15N | water | protons | 4.755 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.755 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.755 ppm | internal | direct | 1.0 |
15N | water | protons | 4.755 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.755 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.755 ppm | internal | direct | 1.0 |
15N | water | protons | 4.755 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.755 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.755 ppm | internal | direct | 1.0 |
15N | water | protons | 4.755 ppm | internal | indirect | 0.1013291 |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | potassium chloride | natural abundance | 2.7 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-99% 15N] | 0.6 mM | |
9 | sodium phosphate | natural abundance | 10 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | potassium chloride | natural abundance | 2.7 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | entity | [U-99% 15N] | 0.6 mM | |
9 | sodium phosphate | natural abundance | 10 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | potassium chloride | natural abundance | 2.7 mM | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity | natural abundance | 0.6 mM | |
16 | sodium phosphate | natural abundance | 10 mM | |
17 | potassium phosphate | natural abundance | 1.8 mM | |
18 | sodium chloride | natural abundance | 140 mM | |
19 | potassium chloride | natural abundance | 2.7 mM | |
20 | H2O | natural abundance | 90 % | |
21 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity | natural abundance | 0.6 mM | |
16 | sodium phosphate | natural abundance | 10 mM | |
17 | potassium phosphate | natural abundance | 1.8 mM | |
18 | sodium chloride | natural abundance | 140 mM | |
19 | potassium chloride | natural abundance | 2.7 mM | |
20 | H2O | natural abundance | 90 % | |
21 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | entity | natural abundance | 0.6 mM | |
16 | sodium phosphate | natural abundance | 10 mM | |
17 | potassium phosphate | natural abundance | 1.8 mM | |
18 | sodium chloride | natural abundance | 140 mM | |
19 | potassium chloride | natural abundance | 2.7 mM | |
20 | H2O | natural abundance | 90 % | |
21 | D2O | natural abundance | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | entity | natural abundance | 0.6 mM | |
23 | sodium phosphate | natural abundance | 10 mM | |
24 | potassium phosphate | natural abundance | 1.8 mM | |
25 | sodium chloride | natural abundance | 140 mM | |
26 | potassium chloride | natural abundance | 2.7 mM | |
27 | D2O | natural abundance | 100 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | entity | natural abundance | 0.6 mM | |
23 | sodium phosphate | natural abundance | 10 mM | |
24 | potassium phosphate | natural abundance | 1.8 mM | |
25 | sodium chloride | natural abundance | 140 mM | |
26 | potassium chloride | natural abundance | 2.7 mM | |
27 | D2O | natural abundance | 100 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | entity | natural abundance | 0.6 mM | |
23 | sodium phosphate | natural abundance | 10 mM | |
24 | potassium phosphate | natural abundance | 1.8 mM | |
25 | sodium chloride | natural abundance | 140 mM | |
26 | potassium chloride | natural abundance | 2.7 mM | |
27 | D2O | natural abundance | 100 % |
Varian Varian NMR System - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
28 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
29 | sodium phosphate | natural abundance | 10 mM | |
30 | potassium phosphate | natural abundance | 1.8 mM | |
31 | sodium chloride | natural abundance | 140 mM | |
32 | potassium chloride | natural abundance | 2.7 mM | |
33 | entity | natural abundance | 0.9 mM | |
34 | H2O | natural abundance | 90 % | |
35 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25564_2n1k.nef |
Input source #2: Coordindates | 2n1k.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMGTTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMGTTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGT ------ PRSDGT |||||| PRSDGT
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 106 | 0 | 0 | 100.0 |
Content subtype: combined_25564_2n1k.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMGTTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGT | || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| G.HM..TTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGT ------ PRSDGT |||||| PRSDGT
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
3 | HIS | ND1 | 227.486 |
3 | HIS | NE2 | 179.982 |
20 | GLN | CD | 180.468 |
30 | TRP | CE2 | 137.786 |
34 | GLN | CD | 180.684 |
40 | TYR | HH | 9.552 |
56 | ASN | CG | 177.18 |
62 | ASN | CG | 178.373 |
70 | GLN | CD | 180.712 |
74 | GLN | CD | 179.514 |
76 | ASN | CG | 176.466 |
85 | ASN | CG | 177.933 |
86 | GLN | CD | 180.22 |
94 | GLN | CD | 180.947 |
95 | GLN | CD | 177.938 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 583 | 556 | 95.4 |
13C chemical shifts | 447 | 427 | 95.5 |
15N chemical shifts | 111 | 97 | 87.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 208 | 192 | 92.3 |
13C chemical shifts | 212 | 197 | 92.9 |
15N chemical shifts | 95 | 84 | 88.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 375 | 364 | 97.1 |
13C chemical shifts | 235 | 230 | 97.9 |
15N chemical shifts | 16 | 13 | 81.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 62 | 98.4 |
13C chemical shifts | 63 | 62 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 24 | 24 | 100.0 |
13C chemical shifts | 23 | 23 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMGTTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......TAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------ PRSDGT | P -
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMGTTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......TAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------ PRSDGT | P -
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMGTTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........APDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------ PRSDGT | P -