Solution NMR Structure of DE NOVO DESIGNED PROTEIN (FDA_60), Northeast Structural Genomics Consortium (NESG) Target OR303
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.1 % (973 of 1023) | 95.1 % (519 of 546) | 95.3 % (367 of 385) | 94.6 % (87 of 92) |
Backbone | 95.8 % (479 of 500) | 95.3 % (161 of 169) | 96.8 % (241 of 249) | 93.9 % (77 of 82) |
Sidechain | 95.0 % (574 of 604) | 95.0 % (358 of 377) | 94.9 % (206 of 217) | 100.0 % (10 of 10) |
Aromatic | 75.8 % (47 of 62) | 77.4 % (24 of 31) | 73.3 % (22 of 30) | 100.0 % (1 of 1) |
Methyl | 100.0 % (74 of 74) | 100.0 % (37 of 37) | 100.0 % (37 of 37) |
1. OR303
MGQWQIKIYS ENEREFRELI ERLEEERPSV QYTETTRNGR RQLTIRSNDK NEVDRILEEV RRKVPNARVR ETETGSLEHH HHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 0.87 mM OR303.005, 90% H2O/10% D2O, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR303.005 | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 0.87 mM OR303.005, 90% H2O/10% D2O, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR303.005 | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 0.87 mM OR303.005, 90% H2O/10% D2O, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR303.005 | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 0.87 mM OR303.005, 90% H2O/10% D2O, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR303.005 | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 0.87 mM OR303.005, 90% H2O/10% D2O, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR303.005 | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 0.87 mM OR303.005, 90% H2O/10% D2O, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR303.005 | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 0.87 mM OR303.005, 90% H2O/10% D2O, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR303.005 | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 0.87 mM OR303.005, 90% H2O/10% D2O, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR303.005 | [U-100% 13C; U-100% 15N] | 0.87 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25611_2n2t.nef |
Input source #2: Coordindates | 2n2t.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80---- MGQWQIKIYSENEREFRELIERLEEERPSVQYTETTRNGRRQLTIRSNDKNEVDRILEEVRRKVPNARVRETETGSLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGQWQIKIYSENEREFRELIERLEEERPSVQYTETTRNGRRQLTIRSNDKNEVDRILEEVRRKVPNARVRETETGSLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 84 | 0 | 0 | 100.0 |
Content subtype: combined_25611_2n2t.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80---- MGQWQIKIYSENEREFRELIERLEEERPSVQYTETTRNGRRQLTIRSNDKNEVDRILEEVRRKVPNARVRETETGSLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GQWQIKIYSENEREFRELIERLEEERPSVQYTETTRNGRRQLTIRSNDKNEVDRILEEVRRKVPNARVRETETGSLEHHHHHH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 546 | 525 | 96.2 |
13C chemical shifts | 385 | 366 | 95.1 |
15N chemical shifts | 105 | 96 | 91.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 169 | 164 | 97.0 |
13C chemical shifts | 168 | 160 | 95.2 |
15N chemical shifts | 82 | 77 | 93.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 377 | 361 | 95.8 |
13C chemical shifts | 217 | 206 | 94.9 |
15N chemical shifts | 23 | 19 | 82.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 37 | 97.4 |
13C chemical shifts | 38 | 37 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 24 | 77.4 |
13C chemical shifts | 30 | 22 | 73.3 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80---- MGQWQIKIYSENEREFRELIERLEEERPSVQYTETTRNGRRQLTIRSNDKNEVDRILEEVRRKVPNARVRETETGSLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GQWQIKIYSENEREFRELIERLEEERPSVQYTETTRNGRRQLTIRSNDKNEVDRILEEVRRKVPNARVRETETGSLEHHHHHH
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80---- MGQWQIKIYSENEREFRELIERLEEERPSVQYTETTRNGRRQLTIRSNDKNEVDRILEEVRRKVPNARVRETETGSLEHHHHHH |||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| .GQWQIKIYSE.EREFRELIERLEEERPSVQYTETTRNGRRQLTIRSNDKNEVDRILEEVRRKVP.ARVRETET --------10--------20--------30--------40--------50--------60--------70----