Amino-terminal domain of Latrodectus hesperus MaSp1 with neutralized acidic cluster
GMGQANTPWS SKANADAFIN SFISAASNTG SFSQDQMENM SLIGNTLMAA MDNMGGRITP SKLQALDMAF ASSVAQIAAS QGGDLGVTTN AIADALTSAF YQTTGVVNSR FISEIRSLIG MFAQASANDV YASAGSG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.6 % (1157 of 1436) | 85.7 % (623 of 727) | 72.3 % (401 of 555) | 86.4 % (133 of 154) |
Backbone | 82.2 % (672 of 818) | 93.7 % (267 of 285) | 68.6 % (273 of 398) | 97.8 % (132 of 135) |
Sidechain | 80.6 % (598 of 742) | 80.5 % (356 of 442) | 85.8 % (241 of 281) | 5.3 % (1 of 19) |
Aromatic | 98.0 % (96 of 98) | 98.0 % (48 of 49) | 100.0 % (48 of 48) | 0.0 % (0 of 1) |
Methyl | 89.2 % (132 of 148) | 89.2 % (66 of 74) | 89.2 % (66 of 74) |
1. entity
GMGQANTPWS SKANADAFIN SFISAASNTG SFSQDQMENM SLIGNTLMAA MDNMGGRITP SKLQALDMAF ASSVAQIAAS QGGDLGVTTN AIADALTSAF YQTTGVVNSR FISEIRSLIG MFAQASANDV YASAGSGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NRN1-3* | [U-95% 13C; U-90% 15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.7 ppm | na | indirect | 1.0 |
1H | water | protons | 4.7 ppm | na | indirect | 1.0 |
15N | water | protons | 4.7 ppm | na | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.7 ppm | na | indirect | 1.0 |
1H | water | protons | 4.7 ppm | na | indirect | 1.0 |
15N | water | protons | 4.7 ppm | na | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.7 ppm | na | indirect | 1.0 |
1H | water | protons | 4.7 ppm | na | indirect | 1.0 |
15N | water | protons | 4.7 ppm | na | indirect | 1.0 |
Bruker Avance II+ - 600 MHz TXI, 5 mm
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NRN1-3* | [U-95% 13C; U-90% 15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz z ; Ultra-Shield, BCU05, TCI-cryo, 5mm
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NRN1-3* | [U-95% 13C; U-90% 15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz z ; Ultra-Shield, BCU05, TCI-cryo, 5mm
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NRN1-3* | [U-95% 13C; U-90% 15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz z ; Ultra-Shield, BCU05, TCI-cryo, 5mm
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NRN1-3* | [U-95% 13C; U-90% 15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance II+ - 600 MHz TXI, 5 mm
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NRN1-3* | [U-95% 13C; U-90% 15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance II+ - 600 MHz TXI, 5 mm
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NRN1-3* | [U-95% 13C; U-90% 15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz z ; Ultra-Shield, BCU05, TCI-cryo, 5mm
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NRN1-3* | [U-95% 13C; U-90% 15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance II+ - 600 MHz TXI, 5 mm
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NRN1-3* | [U-95% 13C; U-90% 15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz z ; Ultra-Shield, BCU05, TCI-cryo, 5mm
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NRN1-3* | [U-95% 13C; U-90% 15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz z ; Ultra-Shield, BCU05, TCI-cryo, 5mm
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NRN1-3* | [U-95% 13C; U-90% 15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz z ; Ultra-Shield, BCU05, TCI-cryo, 5mm
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NRN1-3* | [U-95% 13C; U-90% 15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25643_2n3e.nef |
Input source #2: Coordindates | 2n3e.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMGQANTPWSSKANADAFINSFISAASNTGSFSQDQMENMSLIGNTLMAAMDNMGGRITPSKLQALDMAFASSVAQIAASQGGDLGVTTNAIADALTSAF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMGQANTPWSSKANADAFINSFISAASNTGSFSQDQMENMSLIGNTLMAAMDNMGGRITPSKLQALDMAFASSVAQIAASQGGDLGVTTNAIADALTSAF -------110-------120-------130------- YQTTGVVNSRFISEIRSLIGMFAQASANDVYASAGSG ||||||||||||||||||||||||||||||||||||| YQTTGVVNSRFISEIRSLIGMFAQASANDVYASAGSG
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 137 | 0 | 0 | 100.0 |
Content subtype: combined_25643_2n3e.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMGQANTPWSSKANADAFINSFISAASNTGSFSQDQMENMSLIGNTLMAAMDNMGGRITPSKLQALDMAFASSVAQIAASQGGDLGVTTNAIADALTSAF |||||||||||||||||||||||||||||||||||||||| |||||||||||||||| |||||||||||||||||||||||||||||||||||||||| ..GQANTPWSSKANADAFINSFISAASNTGSFSQDQMENMSL.GNTLMAAMDNMGGRIT.SKLQALDMAFASSVAQIAASQGGDLGVTTNAIADALTSAF -------110-------120-------130------- YQTTGVVNSRFISEIRSLIGMFAQASANDVYASAGSG ||||||| ||||||||||||||||||||||||||||| YQTTGVV.SRFISEIRSLIGMFAQASANDVYASAGSG
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
29 | THR | HG1 | 5.17 |
89 | THR | HG1 | 5.11 |
97 | THR | HG1 | 5.15 |
103 | THR | HG1 | 5.18 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 727 | 614 | 84.5 |
13C chemical shifts | 555 | 367 | 66.1 |
15N chemical shifts | 157 | 128 | 81.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 285 | 263 | 92.3 |
13C chemical shifts | 274 | 131 | 47.8 |
15N chemical shifts | 135 | 127 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 442 | 351 | 79.4 |
13C chemical shifts | 281 | 236 | 84.0 |
15N chemical shifts | 22 | 1 | 4.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 69 | 84.1 |
13C chemical shifts | 82 | 67 | 81.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 45 | 91.8 |
13C chemical shifts | 48 | 45 | 93.8 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMGQANTPWSSKANADAFINSFISAASNTGSFSQDQMENMSLIGNTLMAAMDNMGGRITPSKLQALDMAFASSVAQIAASQGGDLGVTTNAIADALTSAF || ||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||| ...QA.TPWSSKANADAFINSFISAASNTGSFSQDQMENMSLIGNTLMAAMDNMGGRIT..KLQALDMAFASSVAQIAASQGGDLGVTTNAIADALTSAF --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------- YQTTGVVNSRFISEIRSLIGMFAQASANDVYASAGSG ||||||||||||||||||||||||||||||||| YQTTGVVNSRFISEIRSLIGMFAQASANDVYAS -------110-------120-------130---
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMGQANTPWSSKANADAFINSFISAASNTGSFSQDQMENMSLIGNTLMAAMDNMGGRITPSKLQALDMAFASSVAQIAASQGGDLGVTTNAIADALTSAF ||||| ||||||||||||||| ||||||||| || ||| |||||||||||| |||| ||||| |||||||| |||||| ||||||||| ||| | ..GQANT.WSSKANADAFINSFI.AASNTGSFS.DQ.ENM..IGNTLMAAMDNM.GRIT..KLQAL.MAFASSVA.IAASQG.DLGVTTNAI..ALT.A. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------- YQTTGVVNSRFISEIRSLIGMFAQASANDVYASAGSG |||| || || | ||| || || | | ||| YQTT.VV.SR.I..IRS.IG..AQ.S.N.VYA -------110-------120-------130--
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMGQANTPWSSKANADAFINSFISAASNTGSFSQDQMENMSLIGNTLMAAMDNMGGRITPSKLQALDMAFASSVAQIAASQGGDLGVTTNAIADALTSAF |||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| .....NTPWSSKANADAFINSFISAASNT.SFSQDQMENMSLIGNTLMAAMDNMGGRITPSKLQALDMAFASSVAQIAASQ.GDLGVTTNAIADALTSAF --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------- YQTTGVVNSRFISEIRSLIGMFAQASANDVYASAGSG ||||||||||||||||||||||||||||||||| YQTTGVVNSRFISEIRSLIGMFAQASANDVYAS -------110-------120-------130---