Solution NMR Structure of DE NOVO DESIGNED PROTEIN, Rossmann2x2 Fold, Northeast Structural Genomics Consortium (NESG) Target OR446
MGRLVVVVTS EQLKEEVRKK FPQVEVRLVT TEEDAKQVIK EIQKKGVQKV VLVGVSEKLL QKIKQEANVQ VYRVTSNDEL EQVVKDVKGS GLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.5 % (1100 of 1202) | 91.8 % (579 of 631) | 91.3 % (422 of 462) | 90.8 % (99 of 109) |
Backbone | 91.4 % (541 of 592) | 91.1 % (184 of 202) | 92.1 % (269 of 292) | 89.8 % (88 of 98) |
Sidechain | 91.9 % (647 of 704) | 92.1 % (395 of 429) | 91.3 % (241 of 264) | 100.0 % (11 of 11) |
Aromatic | 38.1 % (16 of 42) | 47.6 % (10 of 21) | 28.6 % (6 of 21) | |
Methyl | 99.3 % (135 of 136) | 98.5 % (67 of 68) | 100.0 % (68 of 68) |
1. OR446
MGRLVVVVTS EQLKEEVRKK FPQVEVRLVT TEEDAKQVIK EIQKKGVQKV VLVGVSEKLL QKIKQEANVQ VYRVTSNDEL EQVVKDVKGS GLEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.34 mM OR446.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR446.003 | 1.34 mM | ||
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.34 mM OR446.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR446.003 | 1.34 mM | ||
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.34 mM OR446.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | OR446.003 | 1.34 mM | ||
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298 K, pH 6.5
Experiment name 2D 1H-15N HSQC
List #1 RDC_list_1, RDC code 1DHN, Field strength (1H) 600 MHz, Details Or446 aligned in two medias: Peg/hexanol (media/ori 1) or in Positively Charged Compressed Poly Acrylamide Gel (media/ori 2) - Orientation 1
List #2 RDC_list_2, RDC code 1DHN, Field strength (1H) 600 MHz, Details Or446 aligned in two medias: Peg/hexanol (media/ori 1) or in Positively Charged Compressed Poly Acrylamide Gel (media/ori 2) - Orientation 2
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.34 mM OR446.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | OR446.003 | 1.34 mM | ||
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz at rutgers
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.34 mM OR446.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR446.003 | 1.34 mM | ||
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.34 mM OR446.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | OR446.003 | 1.34 mM | ||
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.34 mM OR446.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | OR446.003 | 1.34 mM | ||
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.34 mM OR446.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | OR446.003 | 1.34 mM | ||
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.34 mM OR446.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | OR446.003 | 1.34 mM | ||
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.34 mM OR446.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | OR446.003 | 1.34 mM | ||
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.34 mM OR446.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | OR446.003 | 1.34 mM | ||
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz at UGA for RDC measurement
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.34 mM OR446.003, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | OR446.003 | 1.34 mM | ||
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25662_2n3z.nef |
Input source #2: Coordindates | 2n3z.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- MGRLVVVVTSEQLKEEVRKKFPQVEVRLVTTEEDAKQVIKEIQKKGVQKVVLVGVSEKLLQKIKQEANVQVYRVTSNDELEQVVKDVKGSGLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGRLVVVVTSEQLKEEVRKKFPQVEVRLVTTEEDAKQVIKEIQKKGVQKVVLVGVSEKLLQKIKQEANVQVYRVTSNDELEQVVKDVKGSGLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 99 | 0 | 0 | 100.0 |
Content subtype: combined_25662_2n3z.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- MGRLVVVVTSEQLKEEVRKKFPQVEVRLVTTEEDAKQVIKEIQKKGVQKVVLVGVSEKLLQKIKQEANVQVYRVTSNDELEQVVKDVKGSGLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GRLVVVVTSEQLKEEVRKKFPQVEVRLVTTEEDAKQVIKEIQKKGVQKVVLVGVSEKLLQKIKQEANVQVYRVTSNDELEQVVKDVKGSGLEH --------10--------20--------30--------40--------50--------60--------70--------80--------90----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 631 | 585 | 92.7 |
13C chemical shifts | 462 | 422 | 91.3 |
15N chemical shifts | 113 | 99 | 87.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 202 | 186 | 92.1 |
13C chemical shifts | 198 | 181 | 91.4 |
15N chemical shifts | 98 | 88 | 89.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 429 | 399 | 93.0 |
13C chemical shifts | 264 | 241 | 91.3 |
15N chemical shifts | 15 | 11 | 73.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 68 | 98.6 |
13C chemical shifts | 69 | 68 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 21 | 10 | 47.6 |
13C chemical shifts | 21 | 6 | 28.6 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- MGRLVVVVTSEQLKEEVRKKFPQVEVRLVTTEEDAKQVIKEIQKKGVQKVVLVGVSEKLLQKIKQEANVQVYRVTSNDELEQVVKDVKGSGLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..RLVVVVTSEQLKEEVRKKFPQVEVRLVTTEEDAKQVIKEIQKKGVQKVVLVGVSEKLLQKIKQEANVQVYRVTSNDELEQVVKDVKGSGLEH --------10--------20--------30--------40--------50--------60--------70--------80--------90----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- MGRLVVVVTSEQLKEEVRKKFPQVEVRLVTTEEDAKQVIKEIQKKGVQKVVLVGVSEKLLQKIKQEANVQVYRVTSNDELEQVVKDVKGSGLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GRLVVVVTSEQLKEEVRKKFPQVEVRLVTTEEDAKQVIKEIQKKGVQKVVLVGVSEKLLQKIKQEANVQVYRVTSNDELEQVVKDVK --------10--------20--------30--------40--------50--------60--------70--------80--------