Novel Structural Components Contribute to the High Thermal Stability of Acyl Carrier Protein from Enterococcus faecalis
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.5 % (740 of 886) | 92.9 % (421 of 453) | 69.5 % (241 of 347) | 90.7 % (78 of 86) |
Backbone | 84.0 % (398 of 474) | 98.1 % (157 of 160) | 69.4 % (163 of 235) | 98.7 % (78 of 79) |
Sidechain | 84.7 % (414 of 489) | 90.1 % (264 of 293) | 79.4 % (150 of 189) | 0.0 % (0 of 7) |
Aromatic | 54.8 % (23 of 42) | 100.0 % (21 of 21) | 9.5 % (2 of 21) | |
Methyl | 83.7 % (87 of 104) | 82.7 % (43 of 52) | 84.6 % (44 of 52) |
1. entity
MTREEVLQKV AKIISNHFDI EADQVTDQLN IKDDLNADSI SVMEFVLELE DEFGTEISDE DAEKIETVGA AVDYIVSNSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 25 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ENTITY | [U-100% 13C; U-100% 15N] | 0.0 ~ 0.0 mM | |
2 | MES | natural abundance | 25 mM | |
3 | Cacl2 | natural abundance | 5 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | D2O | [U-99% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 25 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ENTITY | [U-100% 13C; U-100% 15N] | 0.0 ~ 0.0 mM | |
2 | MES | natural abundance | 25 mM | |
3 | Cacl2 | natural abundance | 5 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | D2O | [U-99% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 25 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ENTITY | [U-100% 13C; U-100% 15N] | 0.0 ~ 0.0 mM | |
2 | MES | natural abundance | 25 mM | |
3 | Cacl2 | natural abundance | 5 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | D2O | [U-99% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 25 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ENTITY | [U-100% 13C; U-100% 15N] | 0.0 ~ 0.0 mM | |
2 | MES | natural abundance | 25 mM | |
3 | Cacl2 | natural abundance | 5 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | D2O | [U-99% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 25 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ENTITY | [U-100% 13C; U-100% 15N] | 0.0 ~ 0.0 mM | |
2 | MES | natural abundance | 25 mM | |
3 | Cacl2 | natural abundance | 5 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | D2O | [U-99% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 25 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ENTITY | [U-100% 13C; U-100% 15N] | 0.0 ~ 0.0 mM | |
2 | MES | natural abundance | 25 mM | |
3 | Cacl2 | natural abundance | 5 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | D2O | [U-99% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 25 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ENTITY | [U-100% 13C; U-100% 15N] | 0.0 ~ 0.0 mM | |
2 | MES | natural abundance | 25 mM | |
3 | Cacl2 | natural abundance | 5 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | D2O | [U-99% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 25 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ENTITY | [U-100% 13C; U-100% 15N] | 0.0 ~ 0.0 mM | |
2 | MES | natural abundance | 25 mM | |
3 | Cacl2 | natural abundance | 5 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | D2O | [U-99% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 25 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ENTITY | [U-100% 13C; U-100% 15N] | 0.0 ~ 0.0 mM | |
2 | MES | natural abundance | 25 mM | |
3 | Cacl2 | natural abundance | 5 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | D2O | [U-99% 2H] | 10 % | |
6 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_25688_2n50.nef |
Input source #2: Coordindates | 2n50.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------- MTREEVLQKVAKIISNHFDIEADQVTDQLNIKDDLNADSISVMEFVLELEDEFGTEISDEDAEKIETVGAAVDYIVSNS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTREEVLQKVAKIISNHFDIEADQVTDQLNIKDDLNADSISVMEFVLELEDEFGTEISDEDAEKIETVGAAVDYIVSNS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 79 | 0 | 0 | 100.0 |
Content subtype: combined_25688_2n50.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------- MTREEVLQKVAKIISNHFDIEADQVTDQLNIKDDLNADSISVMEFVLELEDEFGTEISDEDAEKIETVGAAVDYIVSNS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTREEVLQKVAKIISNHFDIEADQVTDQLNIKDDLNADSISVMEFVLELEDEFGTEISDEDAEKIETVGAAVDYIVSNS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 347 | 229 | 66.0 |
1H chemical shifts | 453 | 421 | 92.9 |
15N chemical shifts | 87 | 78 | 89.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 158 | 78 | 49.4 |
1H chemical shifts | 160 | 157 | 98.1 |
15N chemical shifts | 79 | 78 | 98.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 189 | 151 | 79.9 |
1H chemical shifts | 293 | 264 | 90.1 |
15N chemical shifts | 8 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 54 | 45 | 83.3 |
1H chemical shifts | 54 | 45 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 21 | 1 | 4.8 |
1H chemical shifts | 21 | 21 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------- MTREEVLQKVAKIISNHFDIEADQVTDQLNIKDDLNADSISVMEFVLELEDEFGTEISDEDAEKIETVGAAVDYIVSNS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TREEVLQKVAKIISNHFDIEADQVTDQLNIKDDLNADSISVMEFVLELEDEFGTEISDEDAEKIETVGAAVDYIVSNS