BMRBj - BMREntryMaster

	Total	¹H	¹⁵N
All	52.5 % (212 of 404)	46.8 % (162 of 346)	86.2 % (50 of 58)
Backbone	86.0 % (135 of 157)	80.2 % (85 of 106)	98.0 % (50 of 51)
Sidechain	31.2 % (77 of 247)	32.1 % (77 of 240)	0.0 % (0 of 7)
Aromatic	0.0 % (0 of 28)	0.0 % (0 of 27)	0.0 % (0 of 1)
Methyl	48.3 % (14 of 29)	48.3 % (14 of 29)

1. KIAA0323

GGIRKTRETE RLRRQLLEVF WGQDHKVDFI LQREPYCRDI NQLSEALLSL NF

Show sample condition

Sample

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.8

#	Name	Isotope labeling	Concentration
1	KIAA0323	[U-100% 15N]	0.16 ~ 1.2 mM
2	H2O	natural abundance	90 %
3	D2O	natural abundance	10 %
4	Phosphate Buffer	natural abundance	12 mM

Protein Blocks Logo

Calculated from 10 models in PDB: 2N5M, Strand ID: A Detail

Release date

2016-07-24

Citation

Unveiling the structural determinants of KIAA0323 binding preference for NEDD8
Santonico, E., Nepravishta, R., Mattioni, A., Valentini, E., Mandaliti, W., Procopio, R., Iannuccelli, M., Castagnoli, L., Polo, S., Paci, M., Cesareni, G.
Not known

Related entities 1. KIAA0323 binding preference for NEDD8, : 1 : 6 : 9 entities Detail

Interaction partners 1. KIAA0323 binding preference for NEDD8, : 2 interactors Detail

More details for 2 interactors identified by 2 citations

Experiments performed 5 experiments Detail

NMR combined restraints 6 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_25722_2n5m.nef
Input source #2: Coordindates	2n5m.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

---630-----640-------650-------660-------670--------
GGIRKTRETERLRRQLLEVFWGQDHKVDFILQREPYCRDINQLSEALLSLNF
||||||||||||||||||||||||||||||||||||||||||||||||||||
GGIRKTRETERLRRQLLEVFWGQDHKVDFILQREPYCRDINQLSEALLSLNF
--------10--------20--------30--------40--------50--

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	52	0	0	100.0

Content subtype: combined_25722_2n5m.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	203		96.2 (chain: A, length: 52)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	OK	24 (1)	noe	51.9 (chain: A, length: 52)
2	Distance restraints	CNS/XPLOR_distance_constraints_4	OK	119 (1)	noe	63.5 (chain: A, length: 52)
3	Distance restraints	CNS/XPLOR_distance_constraints_3	OK	40 (1)	hbond	57.7 (chain: A, length: 52)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_5	OK	71 (71)	.	82.7 (chain: A, length: 52)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 52, Sequence coverage: 96.2%
- Total number of assignments
  - ¹H chemical shifts: 153
  - ¹⁵N chemical shifts: 50
- Completeness of assignments
  - Entity_assemble_ID: A
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	346	152	43.9
¹⁵N chemical shifts	65	50	76.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	106	83	78.3
¹⁵N chemical shifts	51	50	98.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	240	69	28.7
¹⁵N chemical shifts	14	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	29	14	48.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	27	0	0.0
¹⁵N chemical shifts	1	0	0.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 52, Sequence coverage: 51.9%
- Total number of restraints: 24
- Weight of restraints: 1.0 (24)
- Potential type of restraints: square-well-parabolic (24)
- Range of distance target values: 2.65, 4.5 (Å)
- Histogram of distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: CNS/XPLOR_distance_constraints_4
  - Status: OK
  - Experiment type: noe
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 52, Sequence coverage: 63.5%
  - Total number of restraints: 119
  - Weight of restraints: 1.0 (119)
  - Potential type of restraints: square-well-parabolic (119)
  - Range of distance target values: 2.65, 4.5 (Å)
  - Histogram of distance target values
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map
  - Saveframe: CNS/XPLOR_distance_constraints_3
    - Status: OK
    - Experiment type: hbond
    - Sequence coverage of experimental data
      - Entity_assembly_ID: A, Chain length: 52, Sequence coverage: 57.7%
    - Total number of restraints: 40
    - Weight of restraints: 1.0 (40)
    - Potential type of restraints: square-well-parabolic (40)
    - Range of distance target values: 2.0, 2.95 (Å)
    - Histogram of distance target values
    - Distance restraints per residue
      - Chain_ID: A
    - Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_5
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 52, Sequence coverage: 82.7%
- Total number of restraints: 71
- Total number of restraints per polymer type: 71
- Weight of restraints: 1.0 (71)
- Potential type of restraints: square-well-parabolic (71)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords Three-helix bundles

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (1.245 seconds)

BMRB: 25722

Sample

Related entities 1. KIAA0323 binding preference for NEDD8, : 1 : 6 : 9 entities Detail

Interaction partners 1. KIAA0323 binding preference for NEDD8, : 2 interactors Detail

Experiments performed 5 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 6 contents Detail