TBK1 recruitment to cytosol-invading Salmonella induces anti-bacterial autophagy
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.1 % (313 of 340) | 97.8 % (175 of 179) | 86.4 % (114 of 132) | 82.8 % (24 of 29) |
Backbone | 93.0 % (160 of 172) | 94.7 % (54 of 57) | 92.1 % (82 of 89) | 92.3 % (24 of 26) |
Sidechain | 91.9 % (181 of 197) | 99.2 % (121 of 122) | 83.3 % (60 of 72) | 0.0 % (0 of 3) |
Aromatic | 45.5 % (10 of 22) | 90.9 % (10 of 11) | 0.0 % (0 of 11) | |
Methyl | 100.0 % (20 of 20) | 100.0 % (10 of 10) | 100.0 % (10 of 10) |
1. NF-KAPPA-B ESSENTIAL MODULATOR
GSPPDFCCPK CQYQAPDMDT LQIHVMECIESolvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NF-KAPPA-B ESSENTIAL MODULATOR | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NF-KAPPA-B ESSENTIAL MODULATOR | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NF-KAPPA-B ESSENTIAL MODULATOR | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NF-KAPPA-B ESSENTIAL MODULATOR | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NF-KAPPA-B ESSENTIAL MODULATOR | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NF-KAPPA-B ESSENTIAL MODULATOR | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NF-KAPPA-B ESSENTIAL MODULATOR | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NF-KAPPA-B ESSENTIAL MODULATOR | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NF-KAPPA-B ESSENTIAL MODULATOR | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water/5% D2O, Pressure 1.000 atm, Temperature 293.000 K, pH 6.500, Details 1.5 mmol/l
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NF-KAPPA-B ESSENTIAL MODULATOR | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25736_5aay.nef |
Input source #2: Coordindates | 5aay.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
2:1:ZN:ZN | 1:8:CYS:SG | unknown | unknown | n/a |
2:1:ZN:ZN | 1:11:CYS:SG | unknown | unknown | n/a |
2:1:ZN:ZN | 1:24:HIS:NE2 | unknown | unknown | n/a |
2:1:ZN:ZN | 1:28:CYS:SG | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
Sequence alignments
390-----400-------410--------- GSPPDFCCPKCQYQAPDMDTLQIHVMECIE |||||||||||||||||||||||||||||| GSPPDFCCPKCQYQAPDMDTLQIHVMECIE --------10--------20--------30
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 30 | 0 | 0 | 100.0 |
Content subtype: combined_25736_5aay.nef
Assigned chemical shifts
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 179 | 174 | 97.2 |
13C chemical shifts | 132 | 114 | 86.4 |
15N chemical shifts | 29 | 24 | 82.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 53 | 93.0 |
13C chemical shifts | 60 | 54 | 90.0 |
15N chemical shifts | 26 | 24 | 92.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 122 | 121 | 99.2 |
13C chemical shifts | 72 | 60 | 83.3 |
15N chemical shifts | 3 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 12 | 12 | 100.0 |
13C chemical shifts | 12 | 12 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 11 | 10 | 90.9 |
13C chemical shifts | 11 | 0 | 0.0 |
Covalent bonds
Distance restraints
Dihedral angle restraints
390-----400-------410--------- GSPPDFCCPKCQYQAPDMDTLQIHVMECIE ||||||||||||||||||||||||| .....FCCPKCQYQAPDMDTLQIHVMECIE