NMR structure of non-sweet mutant (ins18RI19) of sweet protein Brazzein
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.1 % (536 of 678) | 88.4 % (319 of 361) | 62.2 % (158 of 254) | 93.7 % (59 of 63) |
Backbone | 79.6 % (266 of 334) | 94.6 % (106 of 112) | 64.7 % (108 of 167) | 94.5 % (52 of 55) |
Sidechain | 80.7 % (322 of 399) | 85.5 % (213 of 249) | 71.8 % (102 of 142) | 87.5 % (7 of 8) |
Aromatic | 35.5 % (22 of 62) | 71.0 % (22 of 31) | 0.0 % (0 of 31) | |
Methyl | 100.0 % (32 of 32) | 100.0 % (16 of 16) | 100.0 % (16 of 16) |
1. Brz RI
QDKCKKVYEN YPVSKCQLRI ANQCNYDCKL DKHARSGECF YDEKRNLQCI CDYCEYSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Brz_RI | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Brz_RI | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Brz_RI | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Brz_RI | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Brz_RI | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Brz_RI | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Brz_RI | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Brz_RI | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Brz_RI | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Brz_RI | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Brz_RI | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25755_2n69.nef |
Input source #2: Coordindates | 2n69.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:4:CYS:SG | A:54:CYS:SG | oxidized, CA 57.415, CB 41.843 ppm | oxidized, CA 55.143, CB 44.382 ppm | 1.95 |
A:16:CYS:SG | A:39:CYS:SG | oxidized, CA 56.57, CB 41.437 ppm | oxidized, CA 56.728, CB 45.019 ppm | 2.114 |
A:24:CYS:SG | A:49:CYS:SG | oxidized, CA 58.406, CB 38.776 ppm | oxidized, CA 54.955, CB 38.445 ppm | 1.983 |
A:28:CYS:SG | A:51:CYS:SG | oxidized, CA 60.914, CB 36.945 ppm | oxidized, CA 51.818, CB 35.982 ppm | 1.956 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50------ QDKCKKVYENYPVSKCQLRIANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY |||||||||||||||||||||||||||||||||||||||||||||||||||||||| QDKCKKVYENYPVSKCQLRIANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 56 | 0 | 0 | 100.0 |
Content subtype: combined_25755_2n69.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50------ QDKCKKVYENYPVSKCQLRIANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY |||||||||||||||||||||||||||||||||||||||||||||||||||||||| QDKCKKVYENYPVSKCQLRIANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 361 | 327 | 90.6 |
13C chemical shifts | 254 | 159 | 62.6 |
15N chemical shifts | 66 | 59 | 89.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 112 | 108 | 96.4 |
13C chemical shifts | 112 | 54 | 48.2 |
15N chemical shifts | 55 | 52 | 94.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 249 | 219 | 88.0 |
13C chemical shifts | 142 | 105 | 73.9 |
15N chemical shifts | 11 | 7 | 63.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 16 | 16 | 100.0 |
13C chemical shifts | 16 | 16 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 22 | 71.0 |
13C chemical shifts | 31 | 0 | 0.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50------ QDKCKKVYENYPVSKCQLRIANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY |||||||||||||||||||||||||||||||||||||||||||||||||||||| ..KCKKVYENYPVSKCQLRIANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Dihedral angle restraints
--------10--------20--------30--------40--------50------ QDKCKKVYENYPVSKCQLRIANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY ||||||||||||||| |||| |||||||| ||||||||||||||||||||| .DKCKKVYENYPVSKC.LRIA..CNYDCKLD..ARSGECFYDEKRNLQCICDYC --------10--------20--------30--------40--------50----