N-terminal domain of the telomerase catalytic subunit Est2 from Ogataea polymorpha
MRFDQYVDEN KSSDDFEPLI HDLFETRWHG TGREIWIERV KDRKIPSTLV KPNYSHEELI DMLIGYLADN RYENALINGL VTGDDLEIAN SYGFKGRNAV TNLLKSPEFR LVHTIIGTET FLDLLINYSA RMGNVYLWGE LNESNYKTQC KSSENLYFQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 73.8 % (1410 of 1910) | 73.3 % (727 of 992) | 72.8 % (542 of 744) | 81.0 % (141 of 174) |
Backbone | 85.5 % (809 of 946) | 84.9 % (275 of 324) | 86.7 % (405 of 467) | 83.2 % (129 of 155) |
Sidechain | 65.9 % (733 of 1113) | 67.7 % (452 of 668) | 62.9 % (268 of 426) | 68.4 % (13 of 19) |
Aromatic | 30.4 % (59 of 194) | 40.2 % (39 of 97) | 18.1 % (17 of 94) | 100.0 % (3 of 3) |
Methyl | 89.5 % (154 of 172) | 91.9 % (79 of 86) | 87.2 % (75 of 86) |
1. TEN
MRFDQYVDEN KSSDDFEPLI HDLFETRWHG TGREIWIERV KDRKIPSTLV KPNYSHEELI DMLIGYLADN RYENALINGL VTGDDLEIAN SYGFKGRNAV TNLLKSPEFR LVHTIIGTET FLDLLINYSA RMGNVYLWGE LNESNYKTQC KSSENLYFQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | sodium phosphate | natural abundance | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 50 mM |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % w/v | |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | TEN | [U-99% 15N] | protein | 0.8 mM |
9 | sodium phosphate | natural abundance | buffer | 20 mM |
10 | sodium chloride | natural abundance | salt | 50 mM |
11 | DTT | natural abundance | 1 mM | |
12 | sodium azide | natural abundance | 0.02 % w/v | |
13 | H2O | natural abundance | solvent | 90 % |
14 | D2O | [U-2H] | solvent | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
16 | sodium phosphate | natural abundance | buffer | 20 mM |
17 | sodium chloride | natural abundance | salt | 50 mM |
18 | DTT | natural abundance | 1 mM | |
19 | sodium azide | natural abundance | 0.02 % w/v | |
20 | D2O | [U-2H] | solvent | 100 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | TEN | natural abundance | protein | 1.0 mM |
22 | sodium phosphate | natural abundance | buffer | 20 mM |
23 | sodium chloride | natural abundance | salt | 50 mM |
24 | DTT | natural abundance | 1 mM | |
25 | sodium azide | natural abundance | 0.02 % w/v | |
26 | H2O | natural abundance | solvent | 90 % |
27 | D2O | [U-2H] | solvent | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | sodium phosphate | natural abundance | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 50 mM |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % w/v | |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
16 | sodium phosphate | natural abundance | buffer | 20 mM |
17 | sodium chloride | natural abundance | salt | 50 mM |
18 | DTT | natural abundance | 1 mM | |
19 | sodium azide | natural abundance | 0.02 % w/v | |
20 | D2O | [U-2H] | solvent | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
16 | sodium phosphate | natural abundance | buffer | 20 mM |
17 | sodium chloride | natural abundance | salt | 50 mM |
18 | DTT | natural abundance | 1 mM | |
19 | sodium azide | natural abundance | 0.02 % w/v | |
20 | D2O | [U-2H] | solvent | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | sodium phosphate | natural abundance | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 50 mM |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % w/v | |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | sodium phosphate | natural abundance | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 50 mM |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % w/v | |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | sodium phosphate | natural abundance | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 50 mM |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % w/v | |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | sodium phosphate | natural abundance | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 50 mM |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % w/v | |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | sodium phosphate | natural abundance | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 50 mM |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % w/v | |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | sodium phosphate | natural abundance | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 50 mM |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % w/v | |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | sodium phosphate | natural abundance | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 50 mM |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % w/v | |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | sodium phosphate | natural abundance | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 50 mM |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % w/v | |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | TEN | [U-99% 15N] | protein | 0.8 mM |
9 | sodium phosphate | natural abundance | buffer | 20 mM |
10 | sodium chloride | natural abundance | salt | 50 mM |
11 | DTT | natural abundance | 1 mM | |
12 | sodium azide | natural abundance | 0.02 % w/v | |
13 | H2O | natural abundance | solvent | 90 % |
14 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | TEN | [U-99% 15N] | protein | 0.8 mM |
9 | sodium phosphate | natural abundance | buffer | 20 mM |
10 | sodium chloride | natural abundance | salt | 50 mM |
11 | DTT | natural abundance | 1 mM | |
12 | sodium azide | natural abundance | 0.02 % w/v | |
13 | H2O | natural abundance | solvent | 90 % |
14 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | TEN | [U-99% 15N] | protein | 0.8 mM |
9 | sodium phosphate | natural abundance | buffer | 20 mM |
10 | sodium chloride | natural abundance | salt | 50 mM |
11 | DTT | natural abundance | 1 mM | |
12 | sodium azide | natural abundance | 0.02 % w/v | |
13 | H2O | natural abundance | solvent | 90 % |
14 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | TEN | [U-99% 15N] | protein | 0.8 mM |
9 | sodium phosphate | natural abundance | buffer | 20 mM |
10 | sodium chloride | natural abundance | salt | 50 mM |
11 | DTT | natural abundance | 1 mM | |
12 | sodium azide | natural abundance | 0.02 % w/v | |
13 | H2O | natural abundance | solvent | 90 % |
14 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
16 | sodium phosphate | natural abundance | buffer | 20 mM |
17 | sodium chloride | natural abundance | salt | 50 mM |
18 | DTT | natural abundance | 1 mM | |
19 | sodium azide | natural abundance | 0.02 % w/v | |
20 | D2O | [U-2H] | solvent | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | TEN | [U-99% 15N] | protein | 0.8 mM |
9 | sodium phosphate | natural abundance | buffer | 20 mM |
10 | sodium chloride | natural abundance | salt | 50 mM |
11 | DTT | natural abundance | 1 mM | |
12 | sodium azide | natural abundance | 0.02 % w/v | |
13 | H2O | natural abundance | solvent | 90 % |
14 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | TEN | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
16 | sodium phosphate | natural abundance | buffer | 20 mM |
17 | sodium chloride | natural abundance | salt | 50 mM |
18 | DTT | natural abundance | 1 mM | |
19 | sodium azide | natural abundance | 0.02 % w/v | |
20 | D2O | [U-2H] | solvent | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | TEN | natural abundance | protein | 1.0 mM |
22 | sodium phosphate | natural abundance | buffer | 20 mM |
23 | sodium chloride | natural abundance | salt | 50 mM |
24 | DTT | natural abundance | 1 mM | |
25 | sodium azide | natural abundance | 0.02 % w/v | |
26 | H2O | natural abundance | solvent | 90 % |
27 | D2O | [U-2H] | solvent | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25770_5lgf.nef |
Input source #2: Coordindates | 5lgf.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRFDQYVDENKSSDDFEPLIHDLFETRWHGTGREIWIERVKDRKIPSTLVKPNYSHEELIDMLIGYLADNRYENALINGLVTGDDLEIANSYGFKGRNAV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRFDQYVDENKSSDDFEPLIHDLFETRWHGTGREIWIERVKDRKIPSTLVKPNYSHEELIDMLIGYLADNRYENALINGLVTGDDLEIANSYGFKGRNAV -------110-------120-------130-------140-------150--------- TNLLKSPEFRLVHTIIGTETFLDLLINYSARMGNVYLWGELNESNYKTQCKSSENLYFQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TNLLKSPEFRLVHTIIGTETFLDLLINYSARMGNVYLWGELNESNYKTQCKSSENLYFQ
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 159 | 0 | 0 | 100.0 |
Content subtype: combined_25770_5lgf.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRFDQYVDENKSSDDFEPLIHDLFETRWHGTGREIWIERVKDRKIPSTLVKPNYSHEELIDMLIGYLADNRYENALINGLVTGDDLEIANSYGFKGRNAV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| | MRFDQYVDENKSSDDFEPLIHDLFETRWHGTGREIWIERVKDRKIPSTLVKPNYSHEELIDMLIGY..........INGLVTGDDLEIANSYGF.....V -------110-------120-------130-------140-------150--------- TNLLKSPEFRLVHTIIGTETFLDLLINYSARMGNVYLWGELNESNYKTQCKSSENLYFQ |||||||||||||||||||||||||||||||||||||| ||||||||||||||||||| TNLLKSPEFRLVHTIIGTETFLDLLINYSARMGNVYLW..LNESNYKTQCKSSENLYFQ
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
5 | GLN | CD | 179.946 |
149 | GLN | CD | 180.346 |
159 | GLN | CD | 181.156 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 992 | 676 | 68.1 |
13C chemical shifts | 744 | 518 | 69.6 |
15N chemical shifts | 183 | 138 | 75.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 324 | 268 | 82.7 |
13C chemical shifts | 318 | 272 | 85.5 |
15N chemical shifts | 155 | 125 | 80.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 668 | 408 | 61.1 |
13C chemical shifts | 426 | 246 | 57.7 |
15N chemical shifts | 28 | 13 | 46.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 89 | 80 | 89.9 |
13C chemical shifts | 89 | 74 | 83.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 97 | 35 | 36.1 |
13C chemical shifts | 94 | 15 | 16.0 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRFDQYVDENKSSDDFEPLIHDLFETRWHGTGREIWIERVKDRKIPSTLVKPNYSHEELIDMLIGYLADNRYENALINGLVTGDDLEIANSYGFKGRNAV ||||||||||||||||||||||||||||| |||||||||||| ||||||||||||||||||||||||| | |||||||| ||||||||| ||| || MRFDQYVDENKSSDDFEPLIHDLFETRWH.TGREIWIERVKD.KIPSTLVKPNYSHEELIDMLIGYLA....E.ALINGLVT.DDLEIANSY.FKG..AV -------110-------120-------130-------140-------150--------- TNLLKSPEFRLVHTIIGTETFLDLLINYSARMGNVYLWGELNESNYKTQCKSSENLYFQ |||||||||||||||||||||||||||||||||||||| ||||||||| | |||||||| TNLLKSPEFRLVHTIIGTETFLDLLINYSARMGNVYLW.ELNESNYKT.C.SSENLYFQ
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRFDQYVDENKSSDDFEPLIHDLFETRWHGTGREIWIERVKDRKIPSTLVKPNYSHEELIDMLIGYLADNRYENALINGLVTGDDLEIANSYGFKGRNAV ||||||||||||||||||||||||||||||||||||||||| ||| ||||| ||||||||||||||| ||| ||||||||||| ||| .RFDQYVDENKSSDDFEPLIHDLFETRWHGTGREIWIERVKD.KIP.TLVKP.YSHEELIDMLIGYLA........ING...GDDLEIANSYG....NAV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150--------- TNLLKSPEFRLVHTIIGTETFLDLLINYSARMGNVYLWGELNESNYKTQCKSSENLYFQ |||||||||||||||||||||||||||||||||| TNLLKSPEFRLVHTIIGTETFLDLLINYSARMGN -------110-------120-------130----