UBL domain of the human DNA damage-inducible protein homolog 2
MGHHHHHHHH HHSSGHIEGR HMLLTVYCVR RDLSEVTFSL QVDADFELHN FRALCELESG IPAAESQIVY AERPLTDNHR SLASYGLKDG DVVILRQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.1 % (883 of 1103) | 82.0 % (464 of 566) | 76.4 % (334 of 437) | 85.0 % (85 of 100) |
Backbone | 83.6 % (483 of 578) | 81.8 % (162 of 198) | 84.6 % (241 of 285) | 84.2 % (80 of 95) |
Sidechain | 77.6 % (478 of 616) | 82.1 % (302 of 368) | 70.4 % (171 of 243) | 100.0 % (5 of 5) |
Aromatic | 30.0 % (33 of 110) | 60.0 % (33 of 55) | 0.0 % (0 of 55) | |
Methyl | 96.2 % (102 of 106) | 96.2 % (51 of 53) | 96.2 % (51 of 53) |
1. entity
MGHHHHHHHH HHSSGHIEGR HMLLTVYCVR RDLSEVTFSL QVDADFELHN FRALCELESG IPAAESQIVY AERPLTDNHR SLASYGLKDG DVVILRQSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-13C; U-15N] | 0.4 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-13C; U-15N] | 0.4 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-13C; U-15N] | 0.4 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-13C; U-15N] | 0.4 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-13C; U-15N] | 0.4 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-13C; U-15N] | 0.4 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-13C; U-15N] | 0.4 mM |
Bruker Avance - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | entity | [U-13C; U-15N] | 0.4 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25801_2n7d.nef |
Input source #2: Coordindates | 2n7d.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
80-------90-------100-------110-------120-------130-------140-------150-------160-------170------ MGHHHHHHHHHHSSGHIEGRHMLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGHHHHHHHHHHSSGHIEGRHMLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 97 | 0 | 0 | 100.0 |
Content subtype: combined_25801_2n7d.nef
Assigned chemical shifts
80-------90-------100-------110-------120-------130-------140-------150-------160-------170------ MGHHHHHHHHHHSSGHIEGRHMLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...............HIEGRHMLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQ
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 437 | 332 | 76.0 |
1H chemical shifts | 566 | 471 | 83.2 |
15N chemical shifts | 107 | 83 | 77.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 194 | 160 | 82.5 |
1H chemical shifts | 198 | 163 | 82.3 |
15N chemical shifts | 95 | 78 | 82.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 243 | 172 | 70.8 |
1H chemical shifts | 368 | 308 | 83.7 |
15N chemical shifts | 12 | 5 | 41.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 55 | 53 | 96.4 |
1H chemical shifts | 55 | 54 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 55 | 0 | 0.0 |
1H chemical shifts | 55 | 33 | 60.0 |
Distance restraints
80-------90-------100-------110-------120-------130-------140-------150-------160-------170------ MGHHHHHHHHHHSSGHIEGRHMLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQ || |||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||| ................IE..HMLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLT.NHRSLASYGLKDGDVVILRQ
Dihedral angle restraints
80-------90-------100-------110-------120-------130-------140-------150-------160-------170------ MGHHHHHHHHHHSSGHIEGRHMLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...................RHMLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQ