Resonance assignments of [15N, 13C] human DCL-1 (CD302) extracellular domain
MDCPSSTWIQ FQDSCYIFLQ EAIKVESIED VRNQCTDHGA DMISIHNEEE NAFILDTLKK QWKGPDDILL GMFYDTDDAS FKWFDNSNMT FDKWTDQDDD EDLVDTCAFL HIKTGEWKKG NCEVSSVEGT LCKTAIPYKR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.9 % (1606 of 1640) | 97.9 % (830 of 848) | 98.0 % (625 of 638) | 98.1 % (151 of 154) |
Backbone | 98.0 % (817 of 834) | 97.9 % (277 of 283) | 98.1 % (406 of 414) | 97.8 % (134 of 137) |
Sidechain | 98.1 % (922 of 940) | 97.9 % (553 of 565) | 98.3 % (352 of 358) | 100.0 % (17 of 17) |
Aromatic | 96.6 % (170 of 176) | 96.6 % (85 of 88) | 96.4 % (80 of 83) | 100.0 % (5 of 5) |
Methyl | 100.0 % (124 of 124) | 100.0 % (62 of 62) | 100.0 % (62 of 62) |
1. CD302
MDCPSSTWIQ FQDSCYIFLQ EAIKVESIED VRNQCTDHGA DMISIHNEEE NAFILDTLKK QWKGPDDILL GMFYDTDDAS FKWFDNSNMT FDKWTDQDDD EDLVDTCAFL HIKTGEWKKG NCEVSSVEGT LCKTAIPYKRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance III - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.15 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CD302 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | PIPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25802_2nan.nef |
Input source #2: Coordindates | 2nan.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:24:CYS:SG | A:36:CYS:SG | oxidized, CA 52.661, CB 38.285 ppm | oxidized, CA 55.458, CB 47.172 ppm | 2.027 |
A:56:CYS:SG | A:153:CYS:SG | oxidized, CA 54.992, CB 35.11 ppm | oxidized, CA 52.119, CB 40.116 ppm | 1.998 |
A:128:CYS:SG | A:143:CYS:SG | oxidized, CA 59.652, CB 43.916 ppm | oxidized, CA 55.8, CB 42.697 ppm | 2.019 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------30--------40--------50--------60--------70--------80--------90-------100-------110-------120- MDCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------130-------140-------150-------160- EDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR |||||||||||||||||||||||||||||||||||||||| EDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR -------110-------120-------130-------140
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 140 | 0 | 0 | 100.0 |
Content subtype: combined_25802_2nan.nef
Assigned chemical shifts
-------30--------40--------50--------60--------70--------80--------90-------100-------110-------120- MDCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDD ------130-------140-------150-------160- EDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR |||||||||||||||||||||||||||||||||||||||| EDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 848 | 832 | 98.1 |
13C chemical shifts | 638 | 627 | 98.3 |
15N chemical shifts | 156 | 151 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 283 | 277 | 97.9 |
13C chemical shifts | 280 | 275 | 98.2 |
15N chemical shifts | 137 | 132 | 96.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 565 | 555 | 98.2 |
13C chemical shifts | 358 | 352 | 98.3 |
15N chemical shifts | 19 | 19 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 65 | 98.5 |
13C chemical shifts | 66 | 65 | 98.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 88 | 85 | 96.6 |
13C chemical shifts | 83 | 80 | 96.4 |
15N chemical shifts | 5 | 5 | 100.0 |
Covalent bonds
Distance restraints
-------30--------40--------50--------60--------70--------80--------90-------100-------110-------120- MDCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDD ------130-------140-------150-------160- EDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR |||||||||||||||||||||||||||||||||||||||| EDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR
-------30--------40--------50--------60--------70--------80--------90-------100-------110-------120- MDCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDD |||| ||||||| |||||||||||||||||||||||| |||||||||||||||||||||||||| |||||||||| |||||| | ||||| | .DCPS.TWIQFQD.CYIFLQEAIKVESIEDVRNQCTDH.ADMISIHNEEENAFILDTLKKQWKGP.DILLGMFYDT...SFKWFD...M.FDKWT.Q... -------30--------40--------50--------60--------70--------80--------90-------100-------110-------120- ------130-------140-------150-------160- EDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR || || |||||||||||||||| ||||||||||||| ..LV.TC.FLHIKTGEWKKGNCEV..VEGTLCKTAIPYK ------130-------140-------150-------160
-------30--------40--------50--------60--------70--------80--------90-------100-------110-------120- MDCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDD |||| ||||||| |||||||||||||||||||||||| |||||||||||||||||||||||||| |||||||||| |||||| | ||||| | .DCPS.TWIQFQD.CYIFLQEAIKVESIEDVRNQCTDH.ADMISIHNEEENAFILDTLKKQWKGP.DILLGMFYDT...SFKWFD...M.FDKWT.Q... -------30--------40--------50--------60--------70--------80--------90-------100-------110-------120- ------130-------140-------150-------160- EDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR || || |||||||||||||||| ||||||||||||| ..LV.TC.FLHIKTGEWKKGNCEV..VEGTLCKTAIPYK ------130-------140-------150-------160
-------30--------40--------50--------60--------70--------80--------90-------100-------110-------120- MDCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDD ------130-------140-------150-------160- EDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR |||||||||||||||||||||||||||||||||||||||| EDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR
Dihedral angle restraints
-------30--------40--------50--------60--------70--------80--------90-------100-------110-------120- MDCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||| .DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQW.GPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDD. -------30--------40--------50--------60--------70--------80--------90-------100-------110-------120- ------130-------140-------150-------160- EDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR ||||||||||||||||||||| |||||||||||||| EDLVDTCAFLHIKTGEWKKGN..VSSVEGTLCKTAIP ------130-------140-------150--------
-------30--------40--------50--------60--------70--------80--------90-------100-------110-------120- MDCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||| .DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQW.GPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDD. -------30--------40--------50--------60--------70--------80--------90-------100-------110-------120- ------130-------140-------150-------160- EDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR ||||||||||||||||||||| |||||||||||||| EDLVDTCAFLHIKTGEWKKGN..VSSVEGTLCKTAIP ------130-------140-------150--------