UBL protein
MVSLTFKNFK KEKVPLDLEP SNTILETKTK LAQSISCEES QIKLIYSGKV LQDSKTVSEC GLKDGDQVVF MVSQKKSTDP NSSSVDKLAA ALEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.0 % (1065 of 1157) | 93.4 % (563 of 603) | 89.8 % (404 of 450) | 94.2 % (98 of 104) |
Backbone | 94.4 % (555 of 588) | 93.9 % (186 of 198) | 94.9 % (279 of 294) | 93.8 % (90 of 96) |
Sidechain | 90.4 % (601 of 665) | 93.1 % (377 of 405) | 85.7 % (216 of 252) | 100.0 % (8 of 8) |
Aromatic | 24.2 % (15 of 62) | 48.4 % (15 of 31) | 0.0 % (0 of 31) | |
Methyl | 100.0 % (108 of 108) | 100.0 % (54 of 54) | 100.0 % (54 of 54) |
1. UBL protein
MVSLTFKNFK KEKVPLDLEP SNTILETKTK LAQSISCEES QIKLIYSGKV LQDSKTVSEC GLKDGDQVVF MVSQKKSTDP NSSSVDKLAA ALEHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBL protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.1 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | UBL protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
7 | potassium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | DTT | natural abundance | 2 mM | |
10 | sodium azide | natural abundance | 0.1 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBL protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.1 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBL protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.1 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBL protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.1 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBL protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.1 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBL protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.1 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UBL protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | sodium azide | natural abundance | 0.1 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | UBL protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
7 | potassium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | DTT | natural abundance | 2 mM | |
10 | sodium azide | natural abundance | 0.1 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | UBL protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
7 | potassium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | DTT | natural abundance | 2 mM | |
10 | sodium azide | natural abundance | 0.1 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | UBL protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
7 | potassium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | DTT | natural abundance | 2 mM | |
10 | sodium azide | natural abundance | 0.1 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | UBL protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
7 | potassium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | DTT | natural abundance | 2 mM | |
10 | sodium azide | natural abundance | 0.1 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25825_2nbw.nef |
Input source #2: Coordindates | 2nbw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------490-------500-------510-------520-------530-------540-------550-------560-------570-------580- DTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| DTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------590-------600-------610-- DDVLETISAIEHPMTSAIEVLVGSCAYTGTG ||||||||||||||||||||||||||||||| DDVLETISAIEHPMTSAIEVLVGSCAYTGTG -------110-------120-------130-
--------10--------20--------30--------40--------50--------60--------70-------- MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKST |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKST
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 131 | 0 | 0 | 100.0 |
B | B | 78 | 0 | 0 | 100.0 |
Content subtype: combined_25825_2nbw.nef
Assigned chemical shifts
Distance restraints
------490-------500-------510-------520-------530-------540-------550-------560-------570-------580- DTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQV | ||| | ||| ||||||||||||||||||||||||| |||||| ||||||||||||||||||||||||||| |||||| || |||| |||| ..K...AAI..L..AFA.SKNDEVLGLLLPIAASTDLPIETAA.ASLALA.VFVGTCNGDITTSIMDNFLERTAIELK..WVRFLA.AL.ILYM..GEQV ------490-------500-------510-------520-------530-------540-------550-------560-------570-------580- ------590-------600-------610-- DDVLETISAIEHPMTSAIEVLVGSCAYTGTG |||||||||| || |||||| || ||| DDVLETISAI.HP.TSAIEV.VG.CAY ------590-------600--------
--------10--------20--------30--------40--------50--------60--------70-------- MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKST |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKST
------490-------500-------510-------520-------530-------540-------550-------560-------570-------580- DTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQV |||||||||||||| |||||||| || |||||||||||||| ||||||||||||| |||||||||||| ||| ..KISSAAILGLGIAF.....DEVLGLLL.IA........TAAMASLALAHVFV....GDITTSIMDNFLE.........WVRFLALALGIL.....EQV ------490-------500-------510-------520-------530-------540-------550-------560-------570-------580- ------590-------600-------610-- DDVLETISAIEHPMTSAIEVLVGSCAYTGTG |||||||||| ||||||||||| DDVLETISAI....TSAIEVLVGSC ------590-------600------
Dihedral angle restraints
------490-------500-------510-------520-------530-------540-------550-------560-------570-------580- DTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQV ||||| ||||| ||||||||||||| |||||||||||||||||||||||||||||||||||| ||||||||||||| |||| .....SAAIL...IAFAG..NDEVLGLLLPIAA...LPIETAAMASLALAHVFVGTCNGDITTSIMDNFLER........WVRFLALALGILY...GEQV ------490-------500-------510-------520-------530-------540-------550-------560-------570-------580- ------590-------600-------610-- DDVLETISAIEHPMTSAIEVLVGSCAYTGTG ||||||||| |||||||||| ||| DDVLETISA...PMTSAIEVLV.SCA ------590-------600-------
--------10--------20--------30--------40--------50--------60--------70-------- MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKST |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQ --------10--------20--------30--------40--------50--------60--------70----