RIP2 CARD
GIAQQWIQSK REDIVNQMTE ACLNQSLDAL LSRDLIMKED YELVSTKPTR TSKVRQLLDT TDIQGEEFAK VIVQKLKDNK QMGLQPYPEI LVVSRSPSLN LLQNKS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.6 % (1145 of 1278) | 96.4 % (650 of 674) | 77.7 % (377 of 485) | 99.2 % (118 of 119) |
Backbone | 83.9 % (527 of 628) | 100.0 % (211 of 211) | 67.9 % (214 of 315) | 100.0 % (102 of 102) |
Sidechain | 95.8 % (721 of 753) | 94.8 % (439 of 463) | 97.4 % (266 of 273) | 94.1 % (16 of 17) |
Aromatic | 63.2 % (24 of 38) | 63.2 % (12 of 19) | 61.1 % (11 of 18) | 100.0 % (1 of 1) |
Methyl | 100.0 % (132 of 132) | 100.0 % (66 of 66) | 100.0 % (66 of 66) |
1. entity
GIAQQWIQSK REDIVNQMTE ACLNQSLDAL LSRDLIMKED YELVSTKPTR TSKVRQLLDT TDIQGEEFAK VIVQKLKDNK QMGLQPYPEI LVVSRSPSLN LLQNKSSolvent system 90% H2O/10% D2O, Pressure 1 (±1) atm, Temperature 301 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | DTT | [U-98% 2H] | 50 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±1) atm, Temperature 301 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | DTT | [U-98% 2H] | 50 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±1) atm, Temperature 301 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | DTT | [U-98% 2H] | 50 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±1) atm, Temperature 301 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | DTT | [U-98% 2H] | 50 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±1) atm, Temperature 301 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | DTT | [U-98% 2H] | 50 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±1) atm, Temperature 301 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | DTT | [U-98% 2H] | 50 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±1) atm, Temperature 301 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | DTT | [U-98% 2H] | 50 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±1) atm, Temperature 301 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | DTT | [U-98% 2H] | 50 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_25828_2n7z.nef |
Input source #2: Coordindates | 2n7z.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLN ------ LLQNKS |||||| LLQNKS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 106 | 0 | 0 | 100.0 |
Content subtype: combined_25828_2n7z.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLN ------ LLQNKS |||||| LLQNKS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 674 | 648 | 96.1 |
13C chemical shifts | 485 | 372 | 76.7 |
15N chemical shifts | 124 | 122 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 211 | 211 | 100.0 |
13C chemical shifts | 212 | 106 | 50.0 |
15N chemical shifts | 102 | 102 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 463 | 437 | 94.4 |
13C chemical shifts | 273 | 266 | 97.4 |
15N chemical shifts | 22 | 20 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 69 | 100.0 |
13C chemical shifts | 69 | 69 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 19 | 12 | 63.2 |
13C chemical shifts | 18 | 11 | 61.1 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLN ------ LLQNKS |||||| LLQNKS