Solution structure of the FHA domain of TbPar42
GPMVTSTGLL SRVAAVEKAA EIAKPPPPKV VELTEAAKQL PQHIIGVTDP TKLNAQVSYF QCPPWAALPS VACHLQCTRD GLPLPALGLH RFPFYLFGRS KVCDYVLEHP SISSVHAVLV FHGGQRCFVL MDLGSTNGVK LNGNRIEKRR PLPAPVGSSI QFGFSSRVYK VQLGPPSSS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.8 % (1888 of 2057) | 91.8 % (981 of 1069) | 90.2 % (735 of 815) | 99.4 % (172 of 173) |
Backbone | 94.3 % (977 of 1036) | 94.9 % (335 of 353) | 92.4 % (483 of 523) | 99.4 % (159 of 160) |
Sidechain | 90.3 % (1071 of 1186) | 90.2 % (646 of 716) | 90.2 % (412 of 457) | 100.0 % (13 of 13) |
Aromatic | 79.7 % (118 of 148) | 86.5 % (64 of 74) | 72.6 % (53 of 73) | 100.0 % (1 of 1) |
Methyl | 100.0 % (214 of 214) | 100.0 % (107 of 107) | 100.0 % (107 of 107) |
1. entity
GPMVTSTGLL SRVAAVEKAA EIAKPPPPKV VELTEAAKQL PQHIIGVTDP TKLNAQVSYF QCPPWAALPS VACHLQCTRD GLPLPALGLH RFPFYLFGRS KVCDYVLEHP SISSVHAVLV FHGGQRCFVL MDLGSTNGVK LNGNRIEKRR PLPAPVGSSI QFGFSSRVYK VQLGPPSSSSolvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N13C FHA domain in 50mM KPiBuffer+2mM DTT | [U-13C; U-15N] | 0.6 mM | |
2 | KPiBuffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | 15N FHA domain in 50mM KpiBuffer+2mM DTT | [U-15N] | 1mM mM | |
7 | KPiBuffer | natural abundance | 50 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Solvent system 100% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | 13C FHA domain in 50mM KpiBuffer+2mM DTT | [U-13C] | 0.6 mM | |
12 | KPiBuffer | natural abundance | 50 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | D2O | natural abundance | 100 % |
Solvent system 50 mMKPi Buffer + 2mM DTT, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | FHA domain in 50mM KPiBuffer+2mM DTT | natural abundance | 1 mM | |
16 | KPiBuffer | natural abundance | 50 mM | |
17 | DTT | natural abundance | 2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | 15N FHA domain in 50mM KpiBuffer+2mM DTT | [U-15N] | 1mM mM | |
7 | KPiBuffer | natural abundance | 50 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | 13C FHA domain in 50mM KpiBuffer+2mM DTT | [U-13C] | 0.6 mM | |
12 | KPiBuffer | natural abundance | 50 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 50 mMKPi Buffer + 2mM DTT, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | FHA domain in 50mM KPiBuffer+2mM DTT | natural abundance | 1 mM | |
16 | KPiBuffer | natural abundance | 50 mM | |
17 | DTT | natural abundance | 2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 50 mMKPi Buffer + 2mM DTT, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | FHA domain in 50mM KPiBuffer+2mM DTT | natural abundance | 1 mM | |
16 | KPiBuffer | natural abundance | 50 mM | |
17 | DTT | natural abundance | 2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 50 mMKPi Buffer + 2mM DTT, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | FHA domain in 50mM KPiBuffer+2mM DTT | natural abundance | 1 mM | |
16 | KPiBuffer | natural abundance | 50 mM | |
17 | DTT | natural abundance | 2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N13C FHA domain in 50mM KPiBuffer+2mM DTT | [U-13C; U-15N] | 0.6 mM | |
2 | KPiBuffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N13C FHA domain in 50mM KPiBuffer+2mM DTT | [U-13C; U-15N] | 0.6 mM | |
2 | KPiBuffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N13C FHA domain in 50mM KPiBuffer+2mM DTT | [U-13C; U-15N] | 0.6 mM | |
2 | KPiBuffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N13C FHA domain in 50mM KPiBuffer+2mM DTT | [U-13C; U-15N] | 0.6 mM | |
2 | KPiBuffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N13C FHA domain in 50mM KPiBuffer+2mM DTT | [U-13C; U-15N] | 0.6 mM | |
2 | KPiBuffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N13C FHA domain in 50mM KPiBuffer+2mM DTT | [U-13C; U-15N] | 0.6 mM | |
2 | KPiBuffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N13C FHA domain in 50mM KPiBuffer+2mM DTT | [U-13C; U-15N] | 0.6 mM | |
2 | KPiBuffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N13C FHA domain in 50mM KPiBuffer+2mM DTT | [U-13C; U-15N] | 0.6 mM | |
2 | KPiBuffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N13C FHA domain in 50mM KPiBuffer+2mM DTT | [U-13C; U-15N] | 0.6 mM | |
2 | KPiBuffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 15N13C FHA domain in 50mM KPiBuffer+2mM DTT | [U-13C; U-15N] | 0.6 mM | |
2 | KPiBuffer | natural abundance | 50 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | 13C FHA domain in 50mM KpiBuffer+2mM DTT | [U-13C] | 0.6 mM | |
12 | KPiBuffer | natural abundance | 50 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | 13C FHA domain in 50mM KpiBuffer+2mM DTT | [U-13C] | 0.6 mM | |
12 | KPiBuffer | natural abundance | 50 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | 13C FHA domain in 50mM KpiBuffer+2mM DTT | [U-13C] | 0.6 mM | |
12 | KPiBuffer | natural abundance | 50 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | 15N FHA domain in 50mM KpiBuffer+2mM DTT | [U-15N] | 1mM mM | |
7 | KPiBuffer | natural abundance | 50 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 300.15 K, pH 6.23
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | 15N FHA domain in 50mM KpiBuffer+2mM DTT | [U-15N] | 1mM mM | |
7 | KPiBuffer | natural abundance | 50 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25834_2n84.nef |
Input source #2: Coordindates | 2n84.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GPMVTSTGLLSRVAAVEKAAEIAKPPPPKVVELTEAAKQLPQHIIGVTDPTKLNAQVSYFQCPPWAALPSVACHLQCTRDGLPLPALGLHRFPFYLFGRS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPMVTSTGLLSRVAAVEKAAEIAKPPPPKVVELTEAAKQLPQHIIGVTDPTKLNAQVSYFQCPPWAALPSVACHLQCTRDGLPLPALGLHRFPFYLFGRS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 00-------110-------120-------130-------140-------150-------160-------170------- KVCDYVLEHPSISSVHAVLVFHGGQRCFVLMDLGSTNGVKLNGNRIEKRRPLPAPVGSSIQFGFSSRVYKVQLGPPSSS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| KVCDYVLEHPSISSVHAVLVFHGGQRCFVLMDLGSTNGVKLNGNRIEKRRPLPAPVGSSIQFGFSSRVYKVQLGPPSSS -------110-------120-------130-------140-------150-------160-------170---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 179 | 0 | 0 | 100.0 |
Content subtype: combined_25834_2n84.nef
Assigned chemical shifts
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GPMVTSTGLLSRVAAVEKAAEIAKPPPPKVVELTEAAKQLPQHIIGVTDPTKLNAQVSYFQCPPWAALPSVACHLQCTRDGLPLPALGLHRFPFYLFGRS |||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..MVTSTGLLSRVAAVEKAAEIAK...PKVVELTEAAKQLPQHIIGVTDPTKLNAQVSYFQCPPWAALPSVACHLQCTRDGLPLPALGLHRFPFYLFGRS 00-------110-------120-------130-------140-------150-------160-------170------- KVCDYVLEHPSISSVHAVLVFHGGQRCFVLMDLGSTNGVKLNGNRIEKRRPLPAPVGSSIQFGFSSRVYKVQLGPPSSS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||| KVCDYVLEHPSISSVHAVLVFHGGQRCFVLMDLGSTNGVKLNGNRIEKRRPLPAPVGSSIQFGFSSRVYKVQLG..SSS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1069 | 968 | 90.6 |
13C chemical shifts | 815 | 724 | 88.8 |
15N chemical shifts | 182 | 172 | 94.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 353 | 336 | 95.2 |
13C chemical shifts | 358 | 318 | 88.8 |
15N chemical shifts | 160 | 159 | 99.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 716 | 632 | 88.3 |
13C chemical shifts | 457 | 406 | 88.8 |
15N chemical shifts | 22 | 13 | 59.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 109 | 107 | 98.2 |
13C chemical shifts | 109 | 107 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 74 | 64 | 86.5 |
13C chemical shifts | 73 | 53 | 72.6 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GPMVTSTGLLSRVAAVEKAAEIAKPPPPKVVELTEAAKQLPQHIIGVTDPTKLNAQVSYFQCPPWAALPSVACHLQCTRDGLPLPALGLHRFPFYLFGRS |||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..MVTSTGLLSRVAAVEKAAEIAK...PKVVELTEAAKQLPQHIIGVTDPTKLNAQVSYFQCPPWAALPSVACHLQCTRDGLPLPALGLHRFPFYLFGRS 00-------110-------120-------130-------140-------150-------160-------170------- KVCDYVLEHPSISSVHAVLVFHGGQRCFVLMDLGSTNGVKLNGNRIEKRRPLPAPVGSSIQFGFSSRVYKVQLGPPSSS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||| KVCDYVLEHPSISSVHAVLVFHGGQRCFVLMDLGSTNGVKLNGNRIEKRRPLPAPVGSSIQFGFSSRVYKVQLG..SSS
Dihedral angle restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GPMVTSTGLLSRVAAVEKAAEIAKPPPPKVVELTEAAKQLPQHIIGVTDPTKLNAQVSYFQCPPWAALPSVACHLQCTRDGLPLPALGLHRFPFYLFGRS ||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||| ||||||||||||||||||| ||||||||||||||||| .PMVTSTGLLSRVAAVEKAAEIAK...PKVVELTEAAKQLPQHIIGVTDPTKLNAQVSYFQC.PWAALPSVACHLQCTRDGL.LPALGLHRFPFYLFGRS 00-------110-------120-------130-------140-------150-------160-------170------- KVCDYVLEHPSISSVHAVLVFHGGQRCFVLMDLGSTNGVKLNGNRIEKRRPLPAPVGSSIQFGFSSRVYKVQLGPPSSS |||||||||||||||||||||||||||||||||||||||||||||||||| | |||||||||||||||||||| |||| KVCDYVLEHPSISSVHAVLVFHGGQRCFVLMDLGSTNGVKLNGNRIEKRR.L..PVGSSIQFGFSSRVYKVQLG.PSSS